Novus Biologicals products are now on bio-techne.com

FMNL3 Recombinant Protein Antigen

Name: FMNL3 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-84091PEP
Price: 279 USD

Images

There are currently no images for FMNL3 Protein (NBP1-84091PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

FMNL3 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FMNL3. Source: E. coli Amino Acid Sequence: LDLENENMMRVAELEKQLLQREKELESIKETYENTSHQVHTLRRLIKEKEEAFQRRCHLEPNVRGLESVDSEALARVGPAELSEGMPPSDLDLLAPAPPPEEVLPLPPPPAPPLPPPPPPLPDKCP Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	FMNL3
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84091. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	32 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FMNL3 Recombinant Protein Antigen

formin-like 3

Background

FMNL3, also known as Formin-like protein 3, has 3 isoforms, a 1,028 amino acid isoform that is 117 kDs, a 976 amino acid isoform that is 111 kDa and a 1,027 amino acid isoform that is 117 kDa, plays an important role in the regulation of cell morphology and cytoskeletal organization and is required in the control of cell shape and migration. Disease research is currently being studied with relation to FMNL3 and chondrosarcoma and glioblastoma. This protein has been linked to the cytoskeleton organization, actin cytoskeleton organization, regulation of cell shape, cellular component organization, and cell migration pathways in interaction with PRPF40A and YWHAB.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

FMNL2 Antibody

NBP2-24748

Species: Hu, Mu, Pm, Rt

Applications: IHC, IHC-P, WB

FMNL1 Antibody -
BSA Free

NBP2-81988

Immunocytochemistry/ Immunofluorescence FMNL1 Antibody - BSA Free

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, WB

FMN1 Antibody (4F4)

H00342184-M07

Immunocytochemistry/ Immunofluorescence FMN1 Antibody (4F4)

Species: Hu

Applications: ELISA, ICC/IF, WB

FNBP3 Antibody

NBP1-87933

Immunocytochemistry/ Immunofluorescence FNBP3 Antibody

Immunohistochemistry-Paraffin FNBP3 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, Simple Western, WB

FHOD1 Antibody

NBP1-83900

Immunohistochemistry-Paraffin FHOD1 Antibody

(3 Publications)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

DIAPH-2 Antibody

NBP1-85217

(2 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

GRID2IP Antibody

NBP1-94174

Species: Hu

Applications: WB

DIAPH1 Antibody

NB600-231

(2 Publications)

Species: Hu

Applications: IHC, IHC-P, KD, WB

DAAM2 Antibody

NBP2-47496

Immunohistochemistry-Paraffin DAAM2 Antibody

(3 Publications)

Species: Hu

Applications: ICC/IF, IHC, IHC-P

DAAM1 Antibody
(4H3)

H00023002-M03

Proximity Ligation Assay DAAM1 Antibody (4H3)

(1 Publication)

Species: Hu, Mu, Rt

Applications: ELISA, IP, PLA, WB

Filamin B Antibody

NBP1-90286

Immunohistochemistry-Paraffin Filamin B Antibody

(2 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

FMN2 Antibody

NBP2-24615

Immunohistochemistry-Paraffin FMN2 Antibody

Species: Hu

Applications: IHC, IHC-P, WB

DIAPH3 Antibody
(4D5)

H00081624-M01

Species: Hu

Applications: ELISA, ICC/IF, S-ELISA, WB

FNBP1 Antibody

NBP2-48542

Species: Hu

Applications: IHC, IHC-P, WB

FHDC1 Antibody

NBP1-93579

(1 Publication)

Species: Hu

Applications: IHC, IHC-P

WBP4 Antibody

NBP1-84718

Immunohistochemistry-Paraffin WBP4 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

Cortactin Antibody

NBP2-15971

Immunohistochemistry-Paraffin Cortactin Antibody

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, KO, WB

FNBP4 Antibody

NBP2-14022

Immunocytochemistry/ Immunofluorescence FNBP4 Antibody

Immunohistochemistry-Paraffin FNBP4 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

SRGAP2 Antibody

NBP1-88830

Immunohistochemistry-Paraffin SRGAP2 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

Gremlin 1 Antibody
[Unconjugated]

AF956

(1 Review)

(17 Publications)

Species: Hu, Mu

Applications: Block, IHC

Publications for FMNL3 Protein (NBP1-84091PEP) (0)

There are no publications for FMNL3 Protein (NBP1-84091PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FMNL3 Protein (NBP1-84091PEP) (0)

There are no reviews for FMNL3 Protein (NBP1-84091PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FMNL3 Protein (NBP1-84091PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FMNL3 Products

Blogs on FMNL3

There are no specific blogs for FMNL3, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Gremlin was detected in immersion fixed frozen sections of embryonic mouse ribs (15 d.p.c.) using 15 µg/mL Goat Anti-Human/Mouse Gremlin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF956) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.

Gremlin 1 Antibody [Unconjugated]
AF956

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our FMNL3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

FMNL3

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

FMNL3 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

FMNL3 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for FMNL3 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for FMNL3 Protein (NBP1-84091PEP) (0)

Reviews for FMNL3 Protein (NBP1-84091PEP) (0)

FAQs for FMNL3 Protein (NBP1-84091PEP) (0)

Additional FMNL3 Products

Blogs on FMNL3

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics