Home » Flotillin-1 » Flotillin-1 Proteins » Flotillin-1 Recombinant Protein Antigen

Flotillin-1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Flotillin-1 Protein (NBP1-87498PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

Flotillin-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FLOT1.

Source: E. coli

Amino Acid Sequence: HQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FLOT1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87498.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Flotillin-1 Recombinant Protein Antigen

  • flotillin 1
  • flotillin-1
  • integral membrane component of caveolae

Background

Caveolae are small domains on the inner cell membrane involved in vesicular trafficking and signal transduction. FLOT1 encodes a caveolae-associated, integral membrane protein. The function of flotillin 1 has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Caveolin-1
Antibody (7C8)
NB100-615
Flow Cytometry Caveolin-1 Antibody (7C8)
Flow Cytometry Caveolin-1 Antibody (7C8)
Immunocytochemistry/ Immunofluorescence Caveolin-1 Antibody (7C8)
(3 Reviews)
(39 Publications)
Species: Hu, Mu, Rt, Sh
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Flotillin 2
Antibody
NBP1-30881
Western Blot Flotillin 2 Antibody
Immunocytochemistry/ Immunofluorescence Flotillin 2 Antibody
Immunohistochemistry-Paraffin Flotillin 2 Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Stomatin Antibody
NBP1-88561
Western Blot Stomatin Antibody
Western Blot Stomatin Antibody
Immunohistochemistry-Paraffin Stomatin Antibody
Species: Hu
Applications: IHC, IHC-P, WB
PrPC Antibody
NB100-56605
Western Blot PrPC Antibody
Species: Av, Bv, Sh
Applications: WB
Gremlin 1 Antibody
[Unconjugated]
AF956
Immunohistochemistry Gremlin 1 Antibody [Unconjugated]
Immunohistochemistry Gremlin 1 Antibody [Unconjugated]
(1 Review)
(18 Publications)
Species: Hu, Mu
Applications: Block, IHC
Caveolin-3 Antibody
NB110-5029
Immunocytochemistry/ Immunofluorescence Caveolin-3 Antibody
Immunocytochemistry/ Immunofluorescence Caveolin-3 Antibody
Immunohistochemistry-Paraffin Caveolin-3 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
beta Amyloid
Antibody (MOAB-2) - B ...
NBP2-13075
Immunohistochemistry-Frozen beta Amyloid Antibody (MOAB-2) - BSA Free
Immunohistochemistry beta Amyloid Antibody (MOAB-2) - BSA Free
Immunocytochemistry/ Immunofluorescence beta Amyloid Antibody (MOAB-2) - BSA Free
(2 Reviews)
(74 Publications)
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Annexin A2
Antibody (1G7)
H00000302-M02
Immunocytochemistry/ Immunofluorescence Annexin A2 Antibody (1G7)
Immunocytochemistry/ Immunofluorescence Annexin A2 Antibody (1G7)
Western Blot Annexin A2 Antibody (1G7)
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IP, WB
Caveolin-2 Antibody
NBP1-31116
Immunohistochemistry-Paraffin Caveolin-2 Antibody
Western Blot Caveolin-2 Antibody
Immunocytochemistry/ Immunofluorescence Caveolin-2 Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Glucose 6
phosphate isomerase A ...
NBP2-02541
Western Blot Glucose 6 phosphate isomerase Antibody (OTI2D2)
Immunohistochemistry-Paraffin Glucose 6 phosphate isomerase Antibody (OTI2D2)
Immunohistochemistry-Paraffin Glucose 6 phosphate isomerase Antibody (OTI2D2)
(1 Publication)
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
GNPDA1 Antibody
NBP2-24653
Western Blot GNPDA1 Antibody
Immunohistochemistry-Paraffin GNPDA1 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(25 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Cathepsin D
Antibody [Unconjugate
AF1029
Immunohistochemistry Cathepsin D Antibody [Unconjugated]
Immunocytochemistry Cathepsin D Antibody [Unconjugated]
Western Blot Cathepsin D Antibody [Unconjugated]
(54 Publications)
Species: Mu
Applications: ICC, IHC, IP, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(863 Publications)
Species: Hu
Applications: BA
SLC6A3/DAT1
Antibody (mAb16)
NBP2-22164
Western Blot SLC6A3/DAT1 Antibody (mAb16)
Western Blot SLC6A3/DAT1 Antibody (mAb16)
Immunohistochemistry-Paraffin SLC6A3/DAT1 Antibody (mAb16)
(3 Reviews)
(14 Publications)
Species: Hu(-), Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB

Publications for Flotillin-1 Protein (NBP1-87498PEP) (0)

There are no publications for Flotillin-1 Protein (NBP1-87498PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Flotillin-1 Protein (NBP1-87498PEP) (0)

There are no reviews for Flotillin-1 Protein (NBP1-87498PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Flotillin-1 Protein (NBP1-87498PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Flotillin-1 Products

Research Areas for Flotillin-1 Protein (NBP1-87498PEP)

Find related products by research area.

Blogs on Flotillin-1.

Check out the latest blog posts on Flotillin-1.
Taking Biomarker Discovery From 2D to 3D: Increased Biological Activity of EVs Isolated From 3D Prostate Cancer Cultures
Jamshed Arslan, Pharm D, PhD Tissues within the human body are made of a three-dimensional (3D) arrangement of cells working together to perform vital functions. The commonly used 2D monolayer cultures have limited ...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Flotillin-1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol FLOT1