Novus Biologicals products are now on bio-techne.com

FANCM Recombinant Protein Antigen

Images

 
There are currently no images for FANCM Recombinant Protein Antigen (NBP2-55444PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

FANCM Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FANCM.

Source: E. coli

Amino Acid Sequence: LAGTHTSLRLPQEGKGTCILVGGHEITSGLEVISSLRAIHGLQVEVCPLNGCDYIVSNRMVVERRSQSEMLNSVNKNKFIEQIQH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FANCM
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55444.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FANCM Recombinant Protein Antigen

  • ATP-dependent RNA helicase FANCM
  • EC 3.6.1
  • FAAP250EC 3.6.4.13
  • Fanconi anemia, complementation group M
  • Fanconi anemia-associated polypeptide of 250 kDa
  • KIAA1596Fanconi anemia group M protein
  • MGC176453
  • Protein FACM
  • Protein Hef ortholog

Background

The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group M. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2476
Species: Hu
Applications: IHC, WB
NB100-182
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, RNAi, Simple Western, WB
NBP1-31883
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PLA, WB
NB100-2564
Species: Hu
Applications: WB
NBP1-84758
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84608
Species: Hu
Applications: IHC, IHC-P
NB100-308
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
NB100-60440
Species: Hu
Applications: IHC, IHC-P, IP, WB
NB100-56585
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-01743
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-03417
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-52406
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
H00002188-B01P
Species: Hu
Applications: ICC/IF, WB
NB100-464
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP2-01020
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-89929
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00002189-M01
Species: Hu
Applications: ELISA, ICC/IF, IP, KD, WB
H00002176-M01
Species: Hu
Applications: ELISA, ICC/IF, WB

Publications for FANCM Recombinant Protein Antigen (NBP2-55444PEP) (0)

There are no publications for FANCM Recombinant Protein Antigen (NBP2-55444PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FANCM Recombinant Protein Antigen (NBP2-55444PEP) (0)

There are no reviews for FANCM Recombinant Protein Antigen (NBP2-55444PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FANCM Recombinant Protein Antigen (NBP2-55444PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FANCM Products

Array NBP2-55444PEP

Research Areas for FANCM Recombinant Protein Antigen (NBP2-55444PEP)

Find related products by research area.

Blogs on FANCM.

Fanconi Antibodies and Cancer Research
We at Novus Biologicals have an extensive antibody databasedevoted to the 13 Fanconi anaemia complementation (FANC) genes, which are involved in the recognition and repair of damaged DNA.The core complex of 8 proteins (FANCA, B, C, E, F, G, L and M)...  Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FANCM Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FANCM