Home » FABP7/B-FABP » FABP7/B-FABP Proteins » FABP7/B-FABP Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

FABP7/B-FABP Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for FABP7/B-FABP Protein (NBP1-88648PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

FABP7/B-FABP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FABP7.

Source: E. coli

Amino Acid Sequence: MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FABP7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88648.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FABP7/B-FABP Recombinant Protein Antigen

  • BFABP
  • B-FABP
  • B-FABPDKFZp547J2313
  • BLBP
  • BLBPMRG
  • Brain lipid-binding protein
  • Brain-type fatty acid-binding protein
  • FABP7
  • FABPBbrain lipid binding protein
  • fatty acid binding protein 7, brain
  • Fatty acid-binding protein 7
  • fatty acid-binding protein, brain
  • Mammary-derived growth inhibitor related
  • mammary-derived growth inhibitor-related

Background

The protein encoded by this gene is a brain fatty acid binding protein. Fatty acid binding proteins (FABPs) are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs are thought to play roles in fatty acid uptake, transport, and metabolism. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

FABP5/E-FABP
Antibody [Unconjugate
AF1476
Western Blot FABP5/E-FABP Antibody [Unconjugated]
Knockout Validated FABP5/E-FABP Antibody [Unconjugated]
Immunohistochemistry FABP5/E-FABP Antibody [Unconjugated]
(24 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
GOT2 Antibody
NBP2-16708
Immunohistochemistry-Paraffin GOT2 Antibody
Knockout Validated GOT2 Antibody
Western Blot GOT2 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
FABP1/L-FABP
Antibody
NBP1-87695
Western Blot FABP1/L-FABP Antibody
Immunohistochemistry-Paraffin FABP1/L-FABP Antibody
Immunohistochemistry-Paraffin FABP1/L-FABP Antibody
(7 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
FABP3/H-FABP
Antibody (242305) [Un ...
MAB1678
Western Blot FABP3/H-FABP Antibody (242305) [Unconjugated]
Immunohistochemistry FABP3/H-FABP Antibody (242305) [Unconjugated]
Simple Western FABP3/H-FABP Antibody (242305) [Unconjugated]
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
FABP4/A-FABP
Antibody [Unconjugate
AF1443
Immunocytochemistry FABP4/A-FABP Antibody [Unconjugated]
Western Blot FABP4/A-FABP Antibody [Unconjugated]
Immunohistochemistry FABP4/A-FABP Antibody [Unconjugated]
(2 Reviews)
(40 Publications)
Species: Mu, Rt
Applications: ICC, IHC, Simple Western, WB
FABP2/I-FABP
[Biotin]
DY3078
N/A FABP2/I-FABP [Biotin]
(28 Publications)
Species: Hu
Applications: ELISA
GFAP Antibody
NB300-141
Immunohistochemistry GFAP Antibody
Western Blot GFAP Antibody
Western Blot GFAP Antibody
(12 Reviews)
(108 Publications)
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
FACA/FANCA Antibody
NB100-2564
Western Blot FACA/FANCA Antibody
(1 Publication)
Species: Hu
Applications: WB
Frataxin Antibody
(OTI1C12)
NBP2-01743
Flow Cytometry Frataxin Antibody (OTI1C12)
Western Blot Frataxin Antibody (OTI1C12)
Immunohistochemistry-Paraffin Frataxin Antibody (OTI1C12)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
GTF3A Antibody
NBP2-04017
Western Blot GTF3A Antibody
Species: Hu
Applications: IP, WB
CD36 Antibody -
BSA Free
NB400-144
Western Blot CD36 Antibody - BSA Free
Immunohistochemistry CD36 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CD36 Antibody - BSA Free
(9 Reviews)
(130 Publications)
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

FABP8/M-FABP/Myelin P2
AF5866
Western Blot FABP8/M-FABP/Myelin P2 Protein Antibody
Immunohistochemistry FABP8/M-FABP/Myelin P2 Protein Antibody
Immunohistochemistry FABP8/M-FABP/Myelin P2 Protein Antibody
Species: Hu
Applications: IHC, WB
PPAR gamma/NR1C3
Antibody - BSA Free
NBP2-22106
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
Immunohistochemistry-Paraffin PPAR gamma/NR1C3 Antibody - BSA Free
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
(2 Reviews)
(11 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
PPAR alpha/NR1C1
Antibody (3B6/PPAR) - ...
NB300-537
Flow Cytometry PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
Western Blot PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
Flow Cytometry PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
(1 Review)
(16 Publications)
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB
Myoglobin Antibody
[Unconjugated]
G-125-C
Myoglobin Antibody [Unconjugated]
Species: Hu
Nestin Antibody
(196908) [Unconjugate
MAB1259
Immunocytochemistry Nestin Antibody (196908) [Unconjugated]
Intracellular Staining by Flow Cytometry Nestin Antibody (196908) [Unconjugated]
Western Blot Nestin Antibody (196908) [Unconjugated]
(3 Reviews)
(161 Publications)
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow

Publications for FABP7/B-FABP Protein (NBP1-88648PEP) (0)

There are no publications for FABP7/B-FABP Protein (NBP1-88648PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FABP7/B-FABP Protein (NBP1-88648PEP) (0)

There are no reviews for FABP7/B-FABP Protein (NBP1-88648PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FABP7/B-FABP Protein (NBP1-88648PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FABP7/B-FABP Products

Research Areas for FABP7/B-FABP Protein (NBP1-88648PEP)

Find related products by research area.

Blogs on FABP7/B-FABP

There are no specific blogs for FABP7/B-FABP, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Nestin was detected in immersion fixed human fetal neural progenitor cells using 10 µg/mL Human Nestin Monoclonal Antibody (Catalog # MAB1259) for 3 hours at room temperature. Cells were stained (green) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Nestin Antibody (196908) [Unconjugated]
MAB1259
FABP7 was detected in immersion fixed paraffin-embedded sections of human melanoma using 5 µg/mL Goat Anti-Human FABP7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3166) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
FABP7/B-FABP Antibody [Unconjugated]
AF3166
Western Blot: CD36 Antibody [NB400-144] - Mouse primary muscle cell lysate. Western blot image submitted by a verified customer review.
CD36 Antibody - BSA Free
NB400-144

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FABP7/B-FABP Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol FABP7