![Western Blot: Exostosin 1 Antibody [NBP3-03736] - Analysis of extracts of various cell lines, using Exostosin 1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.](http://images.novusbio.com/fullsize/Exostosin-1-Antibody-Western-Blot-NBP3-03736-img0002.jpg "Western Blot: Exostosin 1 Antibody [NBP3-03736] - Analysis of extracts of various cell lines, using Exostosin 1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 467-746 of human Exostosin 1 (NP_000118.2). YYYANLGLKPPSKFTAVIHAVTPLVSQSQPVLKLLVAAAKSQYCAQIIVLWNCDKPLPAKHRWPATAVPVVVIEGESKVMSSRFLPYDNIITDAVLSLDEDTVLSTTEVDFAFTVWQSFPERIVGYPARSHFWDNSKERWGYTSKWTNDYSMVLTGAAIYHKYYHYLYSHYLPASLKNMVDQLANCEDILMNFLVSAVTKLPPIKVTQKKQYKETMMGQTSRASRWADPDHFAQRQSCMNTFASWFGYMPLIHSQMRLDPVLFKDQVSILRKKYRDIERL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | EXT1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 86 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Exostosin 1 Antibody (NBP3-03736)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | EXT1 |
![Immunocytochemistry/Immunofluorescence: Exostosin 1 Antibody [NBP3-03736] -Analysis of NIH/3T3 cells using EXT1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/antibody/nbp3-03736_rabbit-polyclonal-exostosin-1-antibody-immunocytochemistry-immunofluorescence-1620238270..jpg "Immunocytochemistry/Immunofluorescence: Exostosin 1 Antibody [NBP3-03736] -Analysis of NIH/3T3 cells using EXT1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: Exostosin 1 Antibody [NBP3-03736] -Analysis of PC-12 cells using EXT1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/antibody/nbp3-03736_rabbit-polyclonal-exostosin-1-antibody-immunocytochemistry-immunofluorescence-16202382850..jpg "Immunocytochemistry/Immunofluorescence: Exostosin 1 Antibody [NBP3-03736] -Analysis of PC-12 cells using EXT1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: Exostosin 1 Antibody [NBP3-03736] -Analysis of U2OS cells using EXT1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/antibody/nbp3-03736_rabbit-polyclonal-exostosin-1-antibody-immunocytochemistry-immunofluorescence-16202383040..jpg "Immunocytochemistry/Immunofluorescence: Exostosin 1 Antibody [NBP3-03736] -Analysis of U2OS cells using EXT1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: Exostosin 1 Antibody - Azide and BSA Free [NBP3-03736] - Immunofluorescence analysis of HeLa cells using Exostosin 1 Rabbit pAb (A2030) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-03736_rabbit-polyclonal-exostosin-1-antibody-52202519313480.jpg "Immunocytochemistry/ Immunofluorescence: Exostosin 1 Antibody - Azide and BSA Free [NBP3-03736] - Immunofluorescence analysis of HeLa cells using Exostosin 1 Rabbit pAb (A2030) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Western Blot Syndecan-2/CD362 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syndecan-2_AF6585_Western_Blot_11618.jpg)
![Immunohistochemistry Syndecan-2/CD362 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syndecan-2_AF6585_Immunohistochemistry_11640.jpg)
![Flow Cytometry Syndecan-2/CD362 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syndecan-2_AF6585_Flow_Cytometry_11674.jpg)
![Immunohistochemistry PTHLH/PTHrP Antibody (677939) [Unconjugated]](https://images.novusbio.com/images2/PTHLH_MAB6734_Immunohistochemistry_10816.jpg)
![Immunohistochemistry Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Endorepellin_AF2364_Immunohistochemistry_6744.jpg)
![Western Blot TRPS1 Antibody [Unconjugated]](https://images.novusbio.com/images2/TRPS1_AF4838_Western_Blot_5562.jpg)
![Simple Western TRPS1 Antibody [Unconjugated]](https://images.novusbio.com/images2/TRPS1_AF4838_Simple_Western_17010.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")