Do you have information as to what epitope these antibodies bind to (H00006036-D01P and H00006036-B01P)? Also, for developing an ELISA method, do you have a recommended concentration to use these antibodies at?

Name: Eosinophil derived neurotoxin Antibody
Brand: Novus Biologicals
SKU: H00006036-D01P
Price: 549 USD

Question

Accepted Answer

FYI, these two antibodies used the same immunogen (RNASE2 [NP_002925.1, 1 a.a. ~ 161 a.a] full-length human protein) to raise the polyclonal antibodies in rabbit (H00006036-D01P) and mouse (H00006036-B01P); and this is only different between them. Since they are polyclonal ones, the epitopes should cover the entire immunogens. Unfortunately, these two antibodies have never been tested together, as a pair, in sandwich-type ELISA (sELISA). They are more expected to work individually as the detection antibodies in ELISA. The users will need to test whether they can work together in the sELISA setting; apologize for any inconvenience. The datasheet for H00006036-B01P says that it is recommended to use dilution 1:100-1:2000 in ELISA. I anticipate that H00006036-D01P should use the similar dilution in ELISA too. In our experiences, sELISA has better to have a monoclonal antibody (or the antibody raised from a smaller immunogen) as the capture antibody, where a polyclonal (or the larger immunogen-derived antibody) as the detection one; so that the protein target is anchored to the surface by using the smaller region/less epitopes while the rest of epitopes can be used by the detection antibody.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	HuSpecies Glossary
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Conjugate	Unconjugated

Description	Quality control test: Antibody reactive against mammalian transfected lysate.
Immunogen	RNASE2 (NP_002925.1, 1 a.a. - 161 a.a.) full-length human protein. MVPKLFTSQICLLLLLGLLAVEGSLHVKPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII
Isotype	IgG
Clonality	Polyclonal
Host	Rabbit
Gene	RNASE2
Purity	Protein G purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Dilutions	Western Blot
Application Notes	It has been used for WB.

Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer	PBS (pH 7.4)
Preservative	No Preservative
Purity	Protein G purified

Eosinophil derived neurotoxin Antibody

Species Glossary

Images

Product Details

Order Details

Eosinophil derived neurotoxin Antibody Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Eosinophil derived neurotoxin Antibody

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Eosinophil derived neurotoxin Antibody (H00006036-D01P) (0)

Reviews for Eosinophil derived neurotoxin Antibody (H00006036-D01P) (0)

Product General Protocols

Video Protocols

FAQs for Eosinophil derived neurotoxin Antibody (H00006036-D01P). (Showing 1 - 1 of 1 FAQ).

Secondary Antibodies

Isotype Controls

Additional Eosinophil derived neurotoxin Products

Research Areas for Eosinophil derived neurotoxin Antibody (H00006036-D01P)

Blogs on Eosinophil derived neurotoxin

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics

Gene Symbol	RNASE2
Uniprot	NP_002925.1(Human)