Endothelin-1 Antibody (3D6) Summary
Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
Immunogen |
EDN1 (AAH09720, 113 a.a. ~ 212 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRAHW |
Specificity |
EDN1 - endothelin 1 |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
EDN1 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Immunoprecipitation
- Sandwich ELISA
- Western Blot 1:500
|
Application Notes |
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA. |
Publications |
|
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Endothelin-1 Antibody (3D6)
Background
Endothelins (ET) show potent constrictor activity in vascular and non-vascular smooth muscle. This family of 21-amino acid peptides exists in at least three isoforms - ET-1, ET-2, and ET-3, and is produced in endothelial and epithelial cells. ET's can mediate biological effects in cells and tissues, and have been shown to bind to an ET receptor in the lung, kidney, heart, and liver.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IP, WB
Species: Hu
Applications: BA
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, IHC, IP, ICFlow, WB
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP
Publications for Endothelin-1 Antibody (H00001906-M01)(4)
Showing Publications 1 -
4 of 4.
Publications using H00001906-M01 |
Applications |
Species |
Ramshani Z, Fan F, Wei A et al. A multiplexed immuno-sensor for on-line and automated monitoring of tissue culture protein biomarkers Talanta 2021-02-17 [PMID: 33592751] |
|
|
Marion A, Dieudonne FX, Patino-Garcia A et al. Calpain-6 is an endothelin-1 signaling dependent protective factor in chemoresistant osteosarcoma. Int J Cancer. 2011-08-16 [PMID: 21681744] |
|
|
Schildroth J, Rettig-Zimmermann J, Kalk P et al. dothelin type A and B receptors in the control of afferent and efferent arterioles in mice. Nephrol Dial Transplant. 2010-09-02 [PMID: 20813769] |
|
|
Ghoul A, Serova M, Astorgues-Xerri L et al. Epithelial-to-Mesenchymal Transition and Resistance to Ingenol 3-Angelate, a Novel Protein Kinase C Modulator, in Colon Cancer Cells. Cancer Res. 2009-05-15 [PMID: 19417139] |
|
|
Reviews for Endothelin-1 Antibody (H00001906-M01) (0)
There are no reviews for Endothelin-1 Antibody (H00001906-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Endothelin-1 Antibody (H00001906-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Endothelin-1 Products
Research Areas for Endothelin-1 Antibody (H00001906-M01)
Find related products by research area.
|
Blogs on Endothelin-1