![Immunocytochemistry/Immunofluorescence: Endosialin/CD248/TEM1 Antibody [NBP2-14462] - Staining of human cell line ASC TERT1 shows localization to nucleoplasm & plasma membrane. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Endosialin-CD248-TEM1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14462-img0012.jpg "Immunocytochemistry/Immunofluorescence: Endosialin/CD248/TEM1 Antibody [NBP2-14462] - Staining of human cell line ASC TERT1 shows localization to nucleoplasm & plasma membrane. Antibody staining is shown in green.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: EEDEDEAWKAFNGGWTEMPGILWMEPTQPPDFALAYRPSFPEDREPQIPYPEPTWPPPLSAPRVPYHSSVLSVTRPVVVSATH |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CD248 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry CD31/PECAM-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD31_AF3628_Immunohistochemistry_10287.jpg)
![Flow Cytometry CD31/PECAM-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD31_AF3628_Flow_Cytometry_16017.jpg)
![Immunohistochemistry CD31/PECAM-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD31_AF3628_Immunohistochemistry_21486.jpg)
| Publication using NBP2-14462 | Applications | Species |
|---|---|---|
| SUN DX, LIAO GJ, LIU KG et al. Endosialin-expressing bone sarcoma stem-like cells are highly tumor-initiating and invasive. Mol Med Rep 2015-10-01 [PMID: 26300407] (ICC/IF, Human) | ICC/IF | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for Endosialin/CD248/TEM1 Antibody (NBP2-14462)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CD248 |
![Immunohistochemistry-Paraffin: Endosialin/CD248/TEM1 Antibody [NBP2-14462] - Staining in human placenta and tonsil tissues using anti-CD248 antibody. Corresponding CD248 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Endosialin-CD248-TEM1-Antibody-Immunohistochemistry-Paraffin-NBP2-14462-img0010.jpg "Immunohistochemistry-Paraffin: Endosialin/CD248/TEM1 Antibody [NBP2-14462] - Staining in human placenta and tonsil tissues using anti-CD248 antibody. Corresponding CD248 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Endosialin/CD248/TEM1 Antibody [NBP2-14462] - Staining of human placenta shows high expression.](http://images.novusbio.com/fullsize/Endosialin-CD248-TEM1-Antibody-Immunohistochemistry-Paraffin-NBP2-14462-img0008.jpg "Immunohistochemistry-Paraffin: Endosialin/CD248/TEM1 Antibody [NBP2-14462] - Staining of human placenta shows high expression.")
![Immunohistochemistry-Paraffin: Endosialin/CD248/TEM1 Antibody [NBP2-14462] - Staining of human tonsil shows low expression as expected.](http://images.novusbio.com/fullsize/Endosialin-CD248-TEM1-Antibody-Immunohistochemistry-Paraffin-NBP2-14462-img0009.jpg "Immunohistochemistry-Paraffin: Endosialin/CD248/TEM1 Antibody [NBP2-14462] - Staining of human tonsil shows low expression as expected.")
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Western Blot CDC14 Antibody (472508) [Unconjugated]](https://images.novusbio.com/images2/CDC14_MAB4457_Western_Blot_6181.jpg)
![Western Blot CDC14 Antibody (472508) [Unconjugated]](https://images.novusbio.com/images2/CDC14_MAB4457_Western_Blot_23533.jpg)
![Immunocytochemistry Thrombomodulin/BDCA-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Thrombomodulin_AF3894_Immunocytochemistry__Immunofluorescence_17780.jpg)
![Immunohistochemistry Thrombomodulin/BDCA-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Thrombomodulin_AF3894_Immunohistochemistry_24179.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot SOS2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOS2_AF6260_Western_Blot_9542.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")