Embigin/EMB Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse Embigin/EMB (NP_034460.3). Peptide sequence LVAIILLCEVYTHKKKNDPDAGKEFEQIEQLKSDDSNGIENNVPRYRKTD |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
EMB |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Theoretical MW |
37 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for Embigin/EMB Antibody
Background
Embigin (EMB) is a transmembrane glycoprotein belonging to the immunoglobulin superfamily (IgSF) proteins. It is a cell adhesion molecule that is preferentially expressed during mouse embryogenesis (1). Embigin, along with basigin and neuroplastin, form a small subgroup within the IgSF, with all members possessing a glutamate at the same position in the transmembrane domain (2). Mature, human Embigin is highly glycosylated and consists of an extracellular domain (ECD) wjth two Ig domains, a transmembrane region, and a short intracellular region. Within the ECD, human EMB shares 75% and 62% amino acid identity with mouse and rat EMB, respectively. Embigin is an accessory protein of monocarboxylic acid transporter, MCT2 which participates in transporting lactic acid between glial cells and neurons (3). Thus, it may be related to brain energy metabolism and has been investigated as a susceptible gene for schizophrenia (4). Embigin is highly expressed in early embryos of mice, and in the heart, lung, brain and other tissues of adult rats (5, 6). Loss of embigin promotes proliferation, anchorage-independent growth, and migration ability of breast cancer cells (7).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, KO, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, IHC, KO, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Publications for Embigin/EMB Antibody (NBP3-10832) (0)
There are no publications for Embigin/EMB Antibody (NBP3-10832).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Embigin/EMB Antibody (NBP3-10832) (0)
There are no reviews for Embigin/EMB Antibody (NBP3-10832).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Embigin/EMB Antibody (NBP3-10832) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Embigin/EMB Products
Research Areas for Embigin/EMB Antibody (NBP3-10832)
Find related products by research area.
|
Blogs on Embigin/EMB