Home » ELF5 » ELF5 Proteins » ELF5 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ELF5 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ELF5 Recombinant Protein Antigen (NBP2-57358PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ELF5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ELF5.

Source: E. coli

Amino Acid Sequence: QDCHSHSRTSLQSSHLWEFVRDLLLSPEENCGILEWEDREQGIFRVVKSEALAKMW

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ELF5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57358.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ELF5 Recombinant Protein Antigen

  • E74-like factor 5 (ets domain transcription factor)
  • E74-like factor 5
  • Epithelium-restricted ESE-1-related Ets factor
  • Epithelium-specific Ets transcription factor 2
  • ESE2ESE-2
  • ETS-related transcription factor Elf-5

Background

The protein encoded by the ELF5 gene is a member of an epithelium-specific subclass of the Ets transcritpion factor family.In addition to its role in regulating the later stages of terminal differentiation of keratinocytes, it appears toregulate a number of epithelium-specific genes found in tissues containing glandular epithelium such as salivary glandand prostate. It has very low affinity to DNA due to its negative regulatory domain at the amino terminus. Twoalternatively spliced transcript variants encoding different isoforms have been described for this gene. (provided byRefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ELF3/ESE-1 Antibody
NBP1-30873
Immunocytochemistry/ Immunofluorescence ELF3/ESE-1 Antibody
Immunohistochemistry-Paraffin ELF3/ESE-1 Antibody
Western Blot ELF3/ESE-1 Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
EHF Antibody
NBP2-38896
Immunohistochemistry-Paraffin EHF Antibody
Immunohistochemistry-Paraffin EHF Antibody
Immunohistochemistry-Paraffin EHF Antibody
Species: Hu
Applications: IHC, IHC-P
CDX2 Antibody
NBP2-24583
Western Blot CDX2 Antibody
Western Blot CDX2 Antibody
Immunohistochemistry-Paraffin CDX2 Antibody
Species: Bv, Eq, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
STAT5a/b Antibody
[Unconjugated] - Pan ...
AF2168
Western Blot STAT5a/b Antibody [Unconjugated] - Pan Specific
Simple Western STAT5a/b Antibody [Unconjugated] - Pan Specific
Chromatin Immunoprecipitation (ChIP) STAT5a/b Antibody [Unconjugated] - Pan Specific
(28 Publications)
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
Prolactin Antibody
[Unconjugated]
AF1445
Neutralization Prolactin Antibody [Unconjugated]
Western Blot Prolactin Antibody [Unconjugated]
Immunohistochemistry Prolactin Antibody [Unconjugated]
(7 Publications)
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
NANOGP8 Antibody
H00388112-B01P
Western Blot NANOGP8 Antibody
Species: Hu
Applications: WB
Nanog Antibody
[Unconjugated]
AF1997
Chromatin Immunoprecipitation (ChIP) Nanog Antibody [Unconjugated]
Immunocytochemistry Nanog Antibody [Unconjugated]
Immunocytochemistry Nanog Antibody [Unconjugated]
(5 Reviews)
(309 Publications)
Species: Hu
Applications: ChIP, ICC, IHC, Simple Western, WB
Oct-3/4 Antibody
[Unconjugated]
AF1759
Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]
Immunocytochemistry Oct-3/4 Antibody [Unconjugated]
Simple Western Oct-3/4 Antibody [Unconjugated]
(77 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
SPDEF Antibody
NBP2-88355
Western Blot SPDEF Antibody
Western Blot SPDEF Antibody
Western Blot SPDEF Antibody
Species: Hu
Applications: WB
Prolactin R
Antibody (U5)
NB300-561
Immunohistochemistry Prolactin R Antibody (U5)
Immunocytochemistry/ Immunofluorescence Prolactin R Antibody (U5)
Immunocytochemistry/ Immunofluorescence Prolactin R Antibody (U5)
(13 Publications)
Species: Bv, Eq, Ha, Hu, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
EOMES Antibody
AF6166
Immunocytochemistry EOMES Antibody
Intracellular Staining by Flow Cytometry EOMES Antibody
Western Blot EOMES Antibody
(26 Publications)
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
SOX2 Antibody
[Unconjugated]
AF2018
Western Blot SOX2 Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) SOX2 Antibody [Unconjugated]
Simple Western SOX2 Antibody [Unconjugated]
(6 Reviews)
(369 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
Cytokeratin 18
Antibody (810811) [Un ...
MAB7619
Simple Western Cytokeratin 18 Antibody (810811) [Unconjugated]
Western Blot Cytokeratin 18 Antibody (810811) [Unconjugated]
Immunocytochemistry Cytokeratin 18 Antibody (810811) [Unconjugated]
(1 Review)
(4 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Thromboxane
synthase Antibody (OT
NBP2-02710
Flow Cytometry Thromboxane synthase Antibody (OTI2C1)
Flow Cytometry Thromboxane synthase Antibody (OTI2C1)
Flow Cytometry Thromboxane synthase Antibody (OTI2C1)
(1 Publication)
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
SF2 Antibody
NBP2-20324
Western Blot SF2 Antibody
Western Blot SF2 Antibody
Immunohistochemistry-Paraffin SF2 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
SC35 Antibody
NBP2-47290
Immunohistochemistry-Paraffin SC35 Antibody
Immunohistochemistry-Paraffin SC35 Antibody
Immunohistochemistry-Paraffin SC35 Antibody
(1 Review)
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ETV6/Tel Antibody
NBP1-80695
Western Blot ETV6/Tel Antibody
Immunohistochemistry-Paraffin ETV6/Tel Antibody
Immunohistochemistry-Paraffin ETV6/Tel Antibody
(5 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for ELF5 Recombinant Protein Antigen (NBP2-57358PEP) (0)

There are no publications for ELF5 Recombinant Protein Antigen (NBP2-57358PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELF5 Recombinant Protein Antigen (NBP2-57358PEP) (0)

There are no reviews for ELF5 Recombinant Protein Antigen (NBP2-57358PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ELF5 Recombinant Protein Antigen (NBP2-57358PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ELF5 Products

Research Areas for ELF5 Recombinant Protein Antigen (NBP2-57358PEP)

Find related products by research area.

Blogs on ELF5

There are no specific blogs for ELF5, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot shows lysates of D3 mouse embryonic stem cell line, NTera-2 human testicular embryonic carcinoma cell line, F9 mouse teratocarcinoma stem cells, and rat cortical stem cells. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat SOX2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2018) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (HAF017). A specific band was detected for SOX2 at approximately 36 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
SOX2 Antibody [Unconjugated]
AF2018
BG01V human embryonic stem cells were fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. Nanog/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human Nanog Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1997) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The nanog promoter was detected by standard PCR.
Nanog Antibody [Unconjugated]
AF1997

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ELF5 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ELF5