Home » ELF5 » ELF5 Antibodies » ELF5 Antibody
Novus Biologicals products are now on bio-techne.com

ELF5 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: ELF5 Antibody [NBP2-87351] - Host: Rabbit. Target Name: ELF5. Sample Type: COLO205 Whole Cell lysates. Antibody Dilution: 1.0ug/ml
Western Blot: ELF5 Antibody [NBP2-87351] - Host: Rabbit. Target Name: ELF5. Sample Type: COLO205 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ELF5 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ELF5. Peptide sequence: SEALAKMWGQRKKNDRMTYEKLSRALRYYYKTGILERVDRRLVYKFGKNA The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ELF5
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for ELF5 Antibody

  • E74-like factor 5 (ets domain transcription factor)
  • E74-like factor 5
  • Epithelium-restricted ESE-1-related Ets factor
  • Epithelium-specific Ets transcription factor 2
  • ESE2ESE-2
  • ETS-related transcription factor Elf-5

Background

The protein encoded by the ELF5 gene is a member of an epithelium-specific subclass of the Ets transcritpion factor family.In addition to its role in regulating the later stages of terminal differentiation of keratinocytes, it appears toregulate a number of epithelium-specific genes found in tissues containing glandular epithelium such as salivary glandand prostate. It has very low affinity to DNA due to its negative regulatory domain at the amino terminus. Twoalternatively spliced transcript variants encoding different isoforms have been described for this gene. (provided byRefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ELF3/ESE-1 Antibody
NBP1-30873
Immunocytochemistry/ Immunofluorescence ELF3/ESE-1 Antibody
Immunohistochemistry-Paraffin ELF3/ESE-1 Antibody
Western Blot ELF3/ESE-1 Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
EHF Antibody
NBP2-38896
Immunohistochemistry-Paraffin EHF Antibody
Immunohistochemistry-Paraffin EHF Antibody
Immunohistochemistry-Paraffin EHF Antibody
Species: Hu
Applications: IHC, IHC-P
CDX2 Antibody
NBP2-24583
Western Blot CDX2 Antibody
Western Blot CDX2 Antibody
Immunohistochemistry-Paraffin CDX2 Antibody
Species: Bv, Eq, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
STAT5a/b Antibody
[Unconjugated] - Pan ...
AF2168
Western Blot STAT5a/b Antibody [Unconjugated] - Pan Specific
Simple Western STAT5a/b Antibody [Unconjugated] - Pan Specific
Chromatin Immunoprecipitation (ChIP) STAT5a/b Antibody [Unconjugated] - Pan Specific
(28 Publications)
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
Prolactin Antibody
[Unconjugated]
AF1445
Neutralization Prolactin Antibody [Unconjugated]
Western Blot Prolactin Antibody [Unconjugated]
Immunohistochemistry Prolactin Antibody [Unconjugated]
(7 Publications)
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
NANOGP8 Antibody
H00388112-B01P
Western Blot NANOGP8 Antibody
Species: Hu
Applications: WB
Nanog Antibody
[Unconjugated]
AF1997
Chromatin Immunoprecipitation (ChIP) Nanog Antibody [Unconjugated]
Immunocytochemistry Nanog Antibody [Unconjugated]
Immunocytochemistry Nanog Antibody [Unconjugated]
(5 Reviews)
(310 Publications)
Species: Hu
Applications: ChIP, ICC, IHC, Simple Western, WB
Oct-3/4 Antibody
[Unconjugated]
AF1759
Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]
Immunocytochemistry Oct-3/4 Antibody [Unconjugated]
Simple Western Oct-3/4 Antibody [Unconjugated]
(77 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
SPDEF Antibody
NBP2-88355
Western Blot SPDEF Antibody
Western Blot SPDEF Antibody
Western Blot SPDEF Antibody
Species: Hu
Applications: WB
Prolactin R
Antibody (250448)
MAB1167
Neutralization Prolactin R Antibody (250448)
Block/ Neutralize Prolactin R Antibody (250448)
Block/ Neutralize Prolactin R Antibody (250448)
(2 Reviews)
(7 Publications)
Species: Hu
Applications: Neut, WB
EOMES Antibody
AF6166
Immunocytochemistry EOMES Antibody
Intracellular Staining by Flow Cytometry EOMES Antibody
Western Blot EOMES Antibody
(26 Publications)
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
SOX2 Antibody
[Unconjugated]
AF2018
Western Blot SOX2 Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) SOX2 Antibody [Unconjugated]
Simple Western SOX2 Antibody [Unconjugated]
(6 Reviews)
(369 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
Cytokeratin 18
Antibody (810811) [Un ...
MAB7619
Simple Western Cytokeratin 18 Antibody (810811) [Unconjugated]
Western Blot Cytokeratin 18 Antibody (810811) [Unconjugated]
Immunocytochemistry Cytokeratin 18 Antibody (810811) [Unconjugated]
(1 Review)
(4 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Thromboxane
synthase Antibody (OT
NBP2-02710
Flow Cytometry Thromboxane synthase Antibody (OTI2C1)
Flow Cytometry Thromboxane synthase Antibody (OTI2C1)
Flow Cytometry Thromboxane synthase Antibody (OTI2C1)
(1 Publication)
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
SF2 Antibody
NBP2-20324
Western Blot SF2 Antibody
Western Blot SF2 Antibody
Immunohistochemistry-Paraffin SF2 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
SC35 Antibody
NBP2-47290
Immunohistochemistry-Paraffin SC35 Antibody
Immunohistochemistry-Paraffin SC35 Antibody
Immunohistochemistry-Paraffin SC35 Antibody
(1 Review)
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ETV6/Tel Antibody
NBP1-80695
Western Blot ETV6/Tel Antibody
Immunohistochemistry-Paraffin ETV6/Tel Antibody
Immunohistochemistry-Paraffin ETV6/Tel Antibody
(5 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for ELF5 Antibody (NBP2-87351) (0)

There are no publications for ELF5 Antibody (NBP2-87351).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELF5 Antibody (NBP2-87351) (0)

There are no reviews for ELF5 Antibody (NBP2-87351). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ELF5 Antibody (NBP2-87351) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ELF5 Products

Research Areas for ELF5 Antibody (NBP2-87351)

Find related products by research area.

Blogs on ELF5

There are no specific blogs for ELF5, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ELF5 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ELF5