![Western Blot: ELAC2 Antibody [NBP1-84620] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/ELAC2-Antibody-Western-Blot-NBP1-84620-img0008.jpg "Western Blot: ELAC2 Antibody [NBP1-84620] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: WMERFGPDTQHLVLNENCASVHNLRSHKIQTQLNLIHPDIFPLLTSFRCKKEGPTLSVPMVQGECLLKYQLRPRREWQRDAIITCNPEEFIVEALQLPNFQQSVQEYR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ELAC2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Simple_Western_21454.jpg)
![Western Blot EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Western_Blot_21511.jpg)
![Immunocytochemistry EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Immunocytochemistry__Immunofluorescence_17288.jpg)
| Publication using NBP1-84620 | Applications | Species |
|---|---|---|
| Schroeder C, Navid-Hill E, Meiners J et al. Nuclear ELAC2 overexpression is associated with increased hazard for relapse after radical prostatectomy Oncotarget 2019-08-13 [PMID: 31452838] (IHC-P, Human) | IHC-P | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for ELAC2 Antibody (NBP1-84620)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ELAC2 |
![Immunocytochemistry/Immunofluorescence: ELAC2 Antibody [NBP1-84620] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/ELAC2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84620-img0009.jpg "Immunocytochemistry/Immunofluorescence: ELAC2 Antibody [NBP1-84620] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: ELAC2 Antibody [NBP1-84620] - Staining of human testis shows strong nuclear and nucleolar positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/ELAC2-Antibody-Immunohistochemistry-Paraffin-NBP1-84620-img0013.jpg "Immunohistochemistry-Paraffin: ELAC2 Antibody [NBP1-84620] - Staining of human testis shows strong nuclear and nucleolar positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: ELAC2 Antibody [NBP1-84620] - Staining of human fallopian tube shows weak to moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/ELAC2-Antibody-Immunohistochemistry-Paraffin-NBP1-84620-img0010.jpg "Immunohistochemistry-Paraffin: ELAC2 Antibody [NBP1-84620] - Staining of human fallopian tube shows weak to moderate nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: ELAC2 Antibody [NBP1-84620] - Staining of human lymph node shows moderate to strong nuclear positivity in germinal center cells.](http://images.novusbio.com/fullsize/ELAC2-Antibody-Immunohistochemistry-Paraffin-NBP1-84620-img0011.jpg "Immunohistochemistry-Paraffin: ELAC2 Antibody [NBP1-84620] - Staining of human lymph node shows moderate to strong nuclear positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: ELAC2 Antibody [NBP1-84620] - Staining of human skin shows strong positivity in nucleoli in squamous epithelial cells.](http://images.novusbio.com/fullsize/ELAC2-Antibody-Immunohistochemistry-Paraffin-NBP1-84620-img0012.jpg "Immunohistochemistry-Paraffin: ELAC2 Antibody [NBP1-84620] - Staining of human skin shows strong positivity in nucleoli in squamous epithelial cells.")
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_729.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_730.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/Kallikrein_3_DKK300_ELISA_124.jpg)
![Western Blot Protein S/PROS1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Protein_S_AF4036_Western_Blot_17082.jpg)
![Simple Western Protein S/PROS1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Protein_S_AF4036_Simple_Western_18689.jpg)
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")