![Western Blot: EIF2AK1 Antibody [NBP1-83210] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)](http://images.novusbio.com/fullsize/EIF2AK1-Antibody-Western-Blot-NBP1-83210-img0005.jpg "Western Blot: EIF2AK1 Antibody [NBP1-83210] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PDPEYDESDVPAEIQVLKEPLQQPTFPFAVANQLLLVSLLEHLSHVHEPNPLRSRQVFKLLCQTFIKMGLLSSFTCSDEFSSLRLHHNRAITHLMRSAKERVRQDPCEDISRIQKIRSREVALEAQTSRYLNEFEELAILGKGGYGR |
| Predicted Species | Mouse (92%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | EIF2AK1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot PKLR Antibody [Unconjugated]](https://images.novusbio.com/images2/PKLR_AF8519_Western_Blot_16592.jpg)
![Simple Western PKLR Antibody [Unconjugated]](https://images.novusbio.com/images2/af8519_human-mouse-rat-pklr-affinity-purified-pab-simple-western-1342022154119.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for EIF2AK1 Antibody (NBP1-83210)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | EIF2AK1 |
![Immunocytochemistry/Immunofluorescence: EIF2AK1 Antibody [NBP1-83210] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/EIF2AK1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83210-img0006.jpg "Immunocytochemistry/Immunofluorescence: EIF2AK1 Antibody [NBP1-83210] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: EIF2AK1 Antibody [NBP1-83210] - Staining of human corpus, uterine shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/EIF2AK1-Antibody-Immunohistochemistry-Paraffin-NBP1-83210-img0002.jpg "Immunohistochemistry-Paraffin: EIF2AK1 Antibody [NBP1-83210] - Staining of human corpus, uterine shows strong cytoplasmic positivity in glandular cells.")
![Western Blot GCN2 [p Thr899] Antibody](https://images.novusbio.com/images2/GCN2_AF7605_Western_Blot_12440.jpg)
![Western Blot PERK Antibody [Unconjugated]](https://images.novusbio.com/images2/PERK_AF3999_Western_Blot_5379.jpg)
![Knockout Validated PERK Antibody [Unconjugated]](https://images.novusbio.com/images2/PERK_AF3999_Knockout_Validated_22482.jpg)
![Western Blot PERK Antibody [Unconjugated]](https://images.novusbio.com/images/af3999_human-perk-affinity-purified-polyclonal-ab-4120241240258.jpg)
![Immunohistochemistry Corneodesmosin Antibody [Unconjugated]](https://images.novusbio.com/images2/Corneodesmosin_AF5725_Immunohistochemistry_7196.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")