Home » DNAJC3 » DNAJC3 Proteins » Recombinant Human DNAJC3 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human DNAJC3 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human DNAJC3 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-234 of Human DNAJC3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVVFPVPSLLGLQRSLLDDLYLLFWFFLMKKVTFRCLSSAISECLPQSLNLMKFNLLISFLLLWTVRLVSCLRSIHYAVGSKTFLISSKSFMVLCFIFKPIVYLS
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
DNAJC3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
51.48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DNAJC3 GST (N-Term) Protein

  • DnaJ (Hsp40) homolog, subfamily C, member 3
  • HP58
  • Interferon-induced, double-stranded RNA-activated protein kinase inhibitor
  • P58FLJ21288
  • P58IPKProtein kinase inhibitor p58
  • PRKRIdnaJ homolog subfamily C member 3
  • Protein kinase inhibitor of 58 kDa
  • protein-kinase, interferon-inducible double stranded RNA dependent inhibitor

Background

DNAJC3( AAH33823, 1 a.a. - 235 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PKR Antibody - BSA
Free
NBP1-77266
Western Blot PKR Antibody - BSA Free
Western Blot PKR Antibody - BSA Free
Immunohistochemistry-Paraffin PKR Antibody - BSA Free
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
PKLR Antibody
[Unconjugated]
AF8519
Western Blot PKLR Antibody [Unconjugated]
Simple Western PKLR Antibody [Unconjugated]
Species: Hu, Mu, Rt
Applications: Simple Western, WB
GRP78/HSPA5
Antibody - BSA Free
NBP1-06274
Flow Cytometry GRP78/HSPA5 Antibody - BSA Free
Flow Cytometry GRP78/HSPA5 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence GRP78/HSPA5 Antibody - BSA Free
(2 Reviews)
(44 Publications)
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
HLA B Antibody
(2G7B10) - BSA Free
NBP2-61871
ELISA HLA B Antibody (2G7B10) - BSA Free
Flow Cytometry HLA B Antibody (2G7B10) - BSA Free
Immunocytochemistry/ Immunofluorescence HLA B Antibody (2G7B10) - BSA Free
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
LMAN1 Antibody
(OTI1A8)
NBP2-03381
Western Blot LMAN1 Antibody (OTI1A8)
Flow Cytometry LMAN1 Antibody (OTI1A8)
Western Blot LMAN1 Antibody (OTI1A8)
(4 Publications)
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
KIR2DL3/CD158b2
Antibody (180701) [Un ...
MAB2014
Flow Cytometry KIR2DL3/CD158b2 Antibody (180701) [Unconjugated]
(12 Publications)
Species: Hu
Applications: CyTOF-reported, Flow
CD94 Antibody
(131412) [Unconjugate
MAB1058
CD94 Antibody (131412) [Unconjugated]
(4 Publications)
Species: Hu
Applications: Block, CyTOF-ready, Flow
GADD153/CHOP
Antibody (9C8)
NB600-1335
Western Blot GADD153/CHOP Antibody (9C8)
Flow Cytometry GADD153/CHOP Antibody (9C8)
Immunohistochemistry-Paraffin GADD153/CHOP Antibody (9C8)
(3 Reviews)
(46 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Annexin A6 Antibody
NBP1-90149
Western Blot Annexin A6 Antibody
Immunohistochemistry-Paraffin Annexin A6 Antibody
Immunohistochemistry-Paraffin Annexin A6 Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
BMP-3b/GDF-10
Antibody [Unconjugate
AF1543
Immunohistochemistry BMP-3b/GDF-10 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
HLA C Antibody
(DT-9) - BSA Free
NBP2-50419
HLA C Antibody (DT-9) - BSA Free
(7 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IP
CDC2L2 Antibody
NB100-496
Immunohistochemistry-Paraffin CDC2L2 Antibody
Immunoprecipitation CDC2L2 Antibody
Western Blot CDC2L2 Antibody
Species: Hu
Applications: IHC, IHC-P, IP, WB
CDC2L1 Antibody -
Azide and BSA Free
NBP2-92609
Western Blot CDC2L1 Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence CDC2L1 Antibody - Azide and BSA Free
Species: Hu, Mu
Applications: ICC/IF, WB
CDP/CUTL1 Antibody
(2A10)
H00001523-M01
Western Blot CDP/CUTL1 Antibody (2A10)
Immunohistochemistry-Paraffin CDP/CUTL1 Antibody (2A10)
ELISA CDP/CUTL1 Antibody (2A10)
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
SAM68 Antibody
NBP1-19151
Immunohistochemistry-Paraffin SAM68 Antibody
Western Blot SAM68 Antibody
(1 Review)
(2 Publications)
Species: Bv, Hu, Ma
Applications: ICC/IF, IHC, IHC-P, IP, WB
CDC2L6 Antibody
(CL14116)
NBP3-26850
Immunohistochemistry-Paraffin CDC2L6 Antibody (CL14116)
Immunohistochemistry-Paraffin CDC2L6 Antibody (CL14116)
Western Blot CDC2L6 Antibody (CL14116)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
p62/SQSTM1
Antibody (2C11)
H00008878-M01
Immunocytochemistry/ Immunofluorescence p62/SQSTM1 Antibody (2C11)
Western Blot p62/SQSTM1 Antibody (2C11)
Western Blot p62/SQSTM1 Antibody (2C11)
(9 Reviews)
(413 Publications)
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
Recombinant Human
DNAJC3 GST (N-Term) P ...
H00005611-P01
Recombinant Human DNAJC3 GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for DNAJC3 Recombinant Protein (H00005611-P01) (0)

There are no publications for DNAJC3 Recombinant Protein (H00005611-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAJC3 Recombinant Protein (H00005611-P01) (0)

There are no reviews for DNAJC3 Recombinant Protein (H00005611-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNAJC3 Recombinant Protein (H00005611-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DNAJC3 Products

Research Areas for DNAJC3 Recombinant Protein (H00005611-P01)

Find related products by research area.

Blogs on DNAJC3

There are no specific blogs for DNAJC3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunocytochemistry/Immunofluorescence: p62/SQSTM1 Antibody (2C11) [H00008878-M01] - Analysis of p62 in SH-SY5Y cells using anti-p62/SQSTM1 antibody. Red - p62 puncta; Blue - nuclear DAPI; Green - Cytoskeleton. Image from verified customer review.
p62/SQSTM1 Antibody (2C11)
H00008878-M01
Western Blot: GADD153/CHOP Antibody (9C8) [NB600-1335] - Ethanol feeding increases CHOP expression. Image from verified customer review.
GADD153/CHOP Antibody (9C8)
NB600-1335

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DNAJC3 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol DNAJC3