![Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP2-62695] - Staining of human Placenta shows no positivity in trophoblastic cells as expected.](http://images.novusbio.com/fullsize/Desmocollin-1-Antibody-Immunohistochemistry-Paraffin-NBP2-62695-img0008.jpg "Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP2-62695] - Staining of human Placenta shows no positivity in trophoblastic cells as expected.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RQVILQVGVINEAQFSKAASSQTPTMCTTTVTVKIIDSDEGPECHPPVKVIQSQDGFPAGQELLGYKALDPEISSGEGLRYQKLGDEDNWFEINQHTG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DSC1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DSC1 |
![Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP2-62695] - Analysis in human skin and pancreas tissues using Anti-DSC1 antibody. Corresponding DSC1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Desmocollin-1-Antibody-Immunohistochemistry-Paraffin-NBP2-62695-img0001.jpg "Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP2-62695] - Analysis in human skin and pancreas tissues using Anti-DSC1 antibody. Corresponding DSC1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP2-62695] - Staining of human skin shows high expression.](http://images.novusbio.com/fullsize/Desmocollin-1-Antibody-Immunohistochemistry-Paraffin-NBP2-62695-img0002.jpg "Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP2-62695] - Staining of human skin shows high expression.")
![Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP2-62695] - Staining of human hair shows strong membranous and cytoplasmic positivity in internal root sheath.](http://images.novusbio.com/fullsize/Desmocollin-1-Antibody-Immunohistochemistry-Paraffin-NBP2-62695-img0003.jpg "Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP2-62695] - Staining of human hair shows strong membranous and cytoplasmic positivity in internal root sheath.")
![Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP2-62695] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/Desmocollin-1-Antibody-Immunohistochemistry-Paraffin-NBP2-62695-img0004.jpg "Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP2-62695] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP2-62695] - Analysis in human skin and pancreas tissues using NBP2-62695 antibody. Corresponding DSC1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Desmocollin-1-Antibody-Immunohistochemistry-Paraffin-NBP2-62695-img0005.jpg "Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP2-62695] - Analysis in human skin and pancreas tissues using NBP2-62695 antibody. Corresponding DSC1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP2-62695] - Staining of human Endometrium shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/Desmocollin-1-Antibody-Immunohistochemistry-Paraffin-NBP2-62695-img0006.jpg "Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP2-62695] - Staining of human Endometrium shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP2-62695] - Staining of human Pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/Desmocollin-1-Antibody-Immunohistochemistry-Paraffin-NBP2-62695-img0007.jpg "Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP2-62695] - Staining of human Pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP2-62695] - Staining of human Skin shows strong membranous positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/Desmocollin-1-Antibody-Immunohistochemistry-Paraffin-NBP2-62695-img0009.jpg "Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP2-62695] - Staining of human Skin shows strong membranous positivity in squamous epithelial cells.")
![Immunohistochemistry Desmoglein-1 Antibody [Unconjugated] - Propeptide](https://images.novusbio.com/images2/Desmoglein-1_AF944_Immunohistochemistry_9801.jpg)
![Immunohistochemistry Corneodesmosin Antibody [Unconjugated]](https://images.novusbio.com/images2/Corneodesmosin_AF5725_Immunohistochemistry_7196.jpg)
![Simple Western Desmoglein-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Desmoglein2_AF947_Simple_Western_20740.jpg)
![Western Blot Desmoglein-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Desmoglein2_AF947_Western_Blot_20147.jpg)
![Western Blot Kallikrein 7 Antibody [Unconjugated]](https://images.novusbio.com/images2/Kallikrein_7_AF2624_Western_Blot_21474.jpg)
![Immunohistochemistry Kallikrein 7 Antibody [Unconjugated]](https://images.novusbio.com/images2/Kallikrein_7_AF2624_Immunohistochemistry_6755.jpg)
![Enzyme Activity Kallikrein 5 [Unconjugated]](https://images.novusbio.com/images2/Kallikrein_5_1108SE_1835.jpg)
![Western Blot Chk2 [p Thr68] Antibody [Unconjugated]](https://images.novusbio.com/images2/Chk2_AF1626_Western_Blot_5130.jpg)
![Immunocytochemistry Chk2 [p Thr68] Antibody [Unconjugated]](https://images.novusbio.com/images2/Chk2_AF1626_Immunocytochemistry__Immunofluorescence_18847.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")