Home » DCP2 » DCP2 Proteins » Recombinant Human DCP2 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human DCP2 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human DCP2 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-385 of Human DCP2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: METKRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSTGSTPAKPTVEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGKKCEKKLHPRKLQDNFETDAVYDLPSSSEDQLLEHAEGQPVACNGHCKFPFSSRAFLSFKFDHNAIMKILDL
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
DCP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
68.09 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DCP2 GST (N-Term) Protein

  • DCP2 decapping enzyme homolog (S. cerevisiae)
  • EC 3.-
  • FLJ33245
  • hDpc
  • mRNA-decapping enzyme 2
  • nudix (nucleoside diphosphate linked moiety X)-type motif 20
  • Nudix motif 20
  • NUDT20Nucleoside diphosphate-linked moiety X motif 20

Background

DCP2( AAH64593, 1 a.a. - 386 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DCP1B Antibody
NBP1-82018
Western Blot DCP1B Antibody
Immunohistochemistry-Paraffin DCP1B Antibody
Immunocytochemistry/ Immunofluorescence DCP1B Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ACE/CD143 Antibody
[Unconjugated]
AF1513
Immunohistochemistry ACE/CD143 Antibody [Unconjugated]
Western Blot ACE/CD143 Antibody [Unconjugated]
Simple Western ACE/CD143 Antibody [Unconjugated]
(1 Review)
(7 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
DDX6 Antibody
NB200-191
Immunoprecipitation DDX6 Antibody
Immunohistochemistry-Paraffin DDX6 Antibody
Immunocytochemistry/ Immunofluorescence DDX6 Antibody
(1 Review)
(44 Publications)
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Xrn1 Antibody
NB500-191
Western Blot Xrn1 Antibody
Immunoprecipitation Xrn1 Antibody
(8 Publications)
Species: Hu, Mu
Applications: IP, WB
DCPS Antibody
(OTI4H8)
NBP2-45650
Immunohistochemistry DCPS Antibody (OTI4H8)
Immunohistochemistry DCPS Antibody (OTI4H8)
Immunohistochemistry DCPS Antibody (OTI4H8)
Species: Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
EDC4 Antibody
NBP2-13944
Western Blot EDC4 Antibody
Immunohistochemistry-Paraffin EDC4 Antibody
Immunohistochemistry-Paraffin EDC4 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
EDC3 Antibody
(4E3-3A4)
H00080153-M01
Western Blot EDC3 Antibody (4E3-3A4)
Western Blot EDC3 Antibody (4E3-3A4)
(2 Publications)
Species: Hu
Applications: ELISA, WB
LSM1 Antibody
(OTI5C6)
NBP2-00918
Flow Cytometry LSM1 Antibody (OTI5C6)
Flow Cytometry LSM1 Antibody (OTI5C6)
Western Blot LSM1 Antibody (OTI5C6)
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Dcp1a Antibody
(3G4)
H00055802-M06
Immunocytochemistry/ Immunofluorescence Dcp1a Antibody (3G4)
Immunocytochemistry/ Immunofluorescence Dcp1a Antibody (3G4)
Immunocytochemistry/ Immunofluorescence Dcp1a Antibody (3G4)
(1 Review)
(54 Publications)
Species: Hu, I, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, PLA, WB
eIF4E [p Ser209]
Antibody
NB100-81898
Western Blot eIF4E [p Ser209] Antibody
Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody
Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody
(1 Publication)
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
CCR4 Antibody
(205410) [Unconjugate
MAB1567
Flow Cytometry CCR4 Antibody (205410) [Unconjugated]
(28 Publications)
Species: Hu
Applications: CyTOF-reported, Flow
TTP Antibody
(OTI8B5)
NBP2-02105
Flow Cytometry TTP Antibody (OTI8B5)
Western Blot TTP Antibody (OTI8B5)
Immunohistochemistry-Paraffin TTP Antibody (OTI8B5)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
YSK4 Antibody (2A4)
H00080122-M01
Immunocytochemistry/ Immunofluorescence YSK4 Antibody (2A4)
Immunocytochemistry/ Immunofluorescence YSK4 Antibody (2A4)
ELISA YSK4 Antibody (2A4)
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF
CNOT6 Antibody
NBP1-86564
Immunohistochemistry-Paraffin CNOT6 Antibody
Immunocytochemistry/ Immunofluorescence CNOT6 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
SLC36A1 Antibody
NBP2-80524
SLC36A1 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
APPBP2 Antibody -
BSA Free
NBP2-81781
Western Blot APPBP2 Antibody - BSA Free
Immunohistochemistry-Paraffin APPBP2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence APPBP2 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
RENT1/UPF1/hUPF1
Antibody
NB100-368
Western Blot RENT1/UPF1/hUPF1 Antibody
Western Blot RENT1/UPF1/hUPF1 Antibody
(10 Publications)
Species: Hu, Mu
Applications: WB
Splicing factor,
arginine/serine-rich ...
NBP1-87381
Immunohistochemistry-Paraffin Splicing factor, arginine/serine-rich 11 Antibody
Immunohistochemistry-Paraffin Splicing factor, arginine/serine-rich 11 Antibody
Immunohistochemistry-Paraffin Splicing factor, arginine/serine-rich 11 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for DCP2 Recombinant Protein (H00167227-P01) (0)

There are no publications for DCP2 Recombinant Protein (H00167227-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DCP2 Recombinant Protein (H00167227-P01) (0)

There are no reviews for DCP2 Recombinant Protein (H00167227-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DCP2 Recombinant Protein (H00167227-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DCP2 Products

Array H00167227-P01

Blogs on DCP2

There are no specific blogs for DCP2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunocytochemistry/Immunofluorescence: Dcp1a Antibody (3G4) [H00055802-M06] - The MIWI2/MAEL granule is a modified P-body. Localization of P-bodies in gonocytes. Cross section seminiferous tubule from wild-type testis (E18.5) were probed with antibodies against DCP1a. Image collected and cropped by CiteAb from the following publication (https://dx.plos.org/10.1371/journal.pgen.1000764), licensed under a CC-BY license.
Dcp1a Antibody (3G4)
H00055802-M06-50ug
Immunoprecipitation: DDX6 Antibody [NB200-191] - Detection of human DDX6 by Western Blot and Immunoprecipitation. Samples: Whole cell lysate (15 and 50 ug) from HeLa cells. Antibodies: Affinity purified rabbit anti-DDX6 antibody NB200-191 used at 0.04 ug/ml for WB (A and B) and at 3 ug/mg lysate for IP. DDX6 was also immunoprecipitated using rabbit anti-DDX6 antibody NB200-192, but not with 'DDX6 Ab', which is to another epitope from DDX6. Normal rabbit IgG was used as a negative control. Detection: Chemiluminescence with an exposure time of 1 second (A & B).
DDX6 Antibody
NB200-191

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DCP2 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol DCP2