Novus Biologicals products are now on bio-techne.com

DBT Recombinant Protein Antigen

Name: DBT Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-85963PEP
Price: 279 USD

Images

There are currently no images for DBT Protein (NBP1-85963PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

DBT Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DBT. Source: E. coli Amino Acid Sequence: YVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTI Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	DBT
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85963. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DBT Recombinant Protein Antigen

BCATE2BCKAD E2 subunit
BCKADE2
BCKAD-E2
branched chain acyltransferase, E2 component
Branched-chain alpha-keto acid dehydrogenase complex component E2
Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto aciddehydrogenase complex
dihydrolipoamide branched chain transacylase (E2 component of branched chainketo acid dehydrogenase complex; maple syrup urine disease)
dihydrolipoamide branched chain transacylase E2
Dihydrolipoamide branched chain transacylase
dihydrolipoyl transacylase
Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase
E2 component of branched chain alpha-keto acid dehydrogenase complex
E2
E2B
EC 2.3.1.168
lipoamide acyltransferase component of branched-chain alpha-keto aciddehydrogenase complex, mitochondrial
lipoamide acyltransferase component of mitochondrial branched-chain alpha-ketoacid dehydrogenase complex
MGC9061
mitochondrial branched chain alpha-keto acid dehydrogenase transacylase subunit(E2b)

Background

The branched-chain alpha-keto acid dehydrogenase complex (BCKD) is an inner-mitochondrial enzyme complex involved in the breakdown of the branched-chain amino acids isoleucine, leucine, and valine. The BCKD complex is thought to be composed of a core of 24 transacylase (E2) subunits, and associated decarboxylase (E1), dehydrogenase (E3), and regulatory subunits. This gene encodes the transacylase (E2) subunit. Mutations in this gene result in maple syrup urine disease, type 2. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Butyrylcholinesterase/ ...

AF9024

Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]

(2 Publications)

Species: Mu, Rt

Applications: IHC, WB

Elastase Antibody
(CELA3B/1257) - Azide ...

NBP2-54301

Species: Hu, Mu, Rt

Applications: CyTOF-ready, ELISA, IHC, IHC-P, WB

MASA Antibody

NBP2-13961

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(817 Publications)

Species: Hu

Applications: BA

COX-2 Antibody

NB100-689

(1 Review)

(36 Publications)

Species: Hu, Rt

Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB

Dihydrolipoamide
Dehydrogenase/DLD Ant ...

NBP1-31302

Western Blot Dihydrolipoamide Dehydrogenase/DLD Antibody

(1 Review)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, KO, WB

ER alpha/NR3A1
Antibody (33)

NB300-560

Immunohistochemistry-Frozen ER alpha/NR3A1 Antibody (33)

Immunohistochemistry-Paraffin ER alpha/NR3A1 Antibody (33)

(1 Review)

(11 Publications)

Species: Av, Bv, Ma, Hu, Mu, Pm, Rt

Applications: IF, IHC, IHC-Fr, IHC-P, WB

PLOD1 Antibody

NBP2-38770

(3 Publications)

Species: Hu, Mu

Applications: IHC-P, WB

ALDH9A1 Antibody

NBP1-89150

Immunohistochemistry-Paraffin ALDH9A1 Antibody

(3 Publications)

Species: Hu, Rt

Applications: IHC, IHC-P, WB

ILT6/CD85e/LILRA3
Antibody (2E9)

H00011026-M01

(6 Publications)

Species: Hu

Applications: ELISA, WB

BRD2 Antibody

NBP1-30475

Immunocytochemistry/ Immunofluorescence BRD2 Antibody

(1 Review)

(3 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, IP, WB

IL-6 [HRP]

M6000B

(663 Publications)

Species: Mu

Applications: ELISA

Prothrombin
Antibody

NBP1-58268

(1 Review)

(3 Publications)

Species: Hu, Mu

Applications: IHC, IHC-P, WB

TTF2 Antibody (1E8)

H00008458-M06

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, WB

Prolactin Antibody
[Unconjugated]

AF1445

Western Blot Prolactin Antibody [Unconjugated]

Immunohistochemistry Prolactin Antibody [Unconjugated]

(7 Publications)

Species: Mu, Rt

Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB

IL-1 beta/IL-1F2
[Unconjugated]

201-LB

Bioactivity IL-1 beta/IL-1F2 [Unconjugated]

SEC-MALS IL-1 beta/IL-1F2 [Unconjugated]

(594 Publications)

Species: Hu

Applications: BA

PLEKHM1 Antibody

NBP2-38449

Species: Hu

Applications: ICC/IF, IHC, IHC-P

DBT Recombinant
Protein Antigen

NBP1-85963PEP

Species: Hu

Applications: AC

Publications for DBT Protein (NBP1-85963PEP) (0)

There are no publications for DBT Protein (NBP1-85963PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DBT Protein (NBP1-85963PEP) (0)

There are no reviews for DBT Protein (NBP1-85963PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DBT Protein (NBP1-85963PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DBT Products

Research Areas for DBT Protein (NBP1-85963PEP)

Find related products by research area.

Stem Cell Markers

Blogs on DBT

There are no specific blogs for DBT, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our DBT Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

DBT

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

DBT Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

DBT Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for DBT Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for DBT Protein (NBP1-85963PEP) (0)

Reviews for DBT Protein (NBP1-85963PEP) (0)

FAQs for DBT Protein (NBP1-85963PEP) (0)

Additional DBT Products

Research Areas for DBT Protein (NBP1-85963PEP)

Blogs on DBT

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics