![Western Blot: DAZL Antibody [NBP1-85307] - Analysis in control (vector only transfected HEK293T lysate) and DAZL over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/DAZL-Antibody-Western-Blot-NBP1-85307-img0009.jpg "Western Blot: DAZL Antibody [NBP1-85307] - Analysis in control (vector only transfected HEK293T lysate) and DAZL over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PTYPNSPVQVITGYQLPVYNYQMPPQWPVGEQRSYVVPPAYSAVNYHCNEVDPGAEVVPNECS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DAZL |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Simple_Western_17480.jpg)
![Western Blot CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Western_Blot_18637.jpg)
![Immunohistochemistry CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/SCF_R_AF1356_Immunohistochemistry_9746.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DAZL |
![Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85307] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/DAZL-Antibody-Immunohistochemistry-Paraffin-NBP1-85307-img0017.jpg "Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85307] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85307] - Analysis in human testis and endometrium tissues. Corresponding DAZL RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/DAZL-Antibody-Immunohistochemistry-Paraffin-NBP1-85307-img0011.jpg "Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85307] - Analysis in human testis and endometrium tissues. Corresponding DAZL RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85307] - Staining of human cerebral cortex shows no positivity in neurons as expected.](http://images.novusbio.com/fullsize/DAZL-Antibody-Immunohistochemistry-Paraffin-NBP1-85307-img0012.jpg "Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85307] - Staining of human cerebral cortex shows no positivity in neurons as expected.")
![Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85307] - Staining of human cerebral cortex, endometrium, prostate and testis using Anti-DAZL antibody NBP1-85307 (A) shows similar protein distribution across tissues to independent antibody NBP1-85306 (B).](http://images.novusbio.com/fullsize/DAZL-Antibody-Immunohistochemistry-Paraffin-NBP1-85307-img0014.jpg "Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85307] - Staining of human cerebral cortex, endometrium, prostate and testis using Anti-DAZL antibody NBP1-85307 (A) shows similar protein distribution across tissues to independent antibody NBP1-85306 (B).")
![Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85307] - Staining of human endometrium shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/DAZL-Antibody-Immunohistochemistry-Paraffin-NBP1-85307-img0015.jpg "Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85307] - Staining of human endometrium shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85307] - Staining of human prostate shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/DAZL-Antibody-Immunohistochemistry-Paraffin-NBP1-85307-img0016.jpg "Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85307] - Staining of human prostate shows no positivity in glandular cells as expected.")
![Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Chromatin_Immunoprecipitation_11218.jpg)
![Immunocytochemistry Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Immunocytochemistry_7093.jpg)
![Simple Western Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct3_4_AF1759_Simple_Western_20183.jpg)
![Western Blot VASA Antibody [Unconjugated]](https://images.novusbio.com/images2/VASA_AF2030_Western_Blot_16711.jpg)
![Immunohistochemistry VASA Antibody [Unconjugated]](https://images.novusbio.com/images2/VASA_AF2030_Immunohistochemistry_7144.jpg)
![Immunohistochemistry VASA Antibody [Unconjugated]](https://images.novusbio.com/images/af2030_human-vasa-affinity-purified-polyclonal-ab-4120241239493.jpg)
![Chromatin Immunoprecipitation (ChIP) Nanog Antibody [Unconjugated]](https://images.novusbio.com/images2/Nanog_AF1997_Chromatin_Immunoprecipitation_11222.jpg)
![Immunocytochemistry Nanog Antibody [Unconjugated]](https://images.novusbio.com/images2/Nanog_AF1997_Immunocytochemistry_6478.jpg)
![Immunocytochemistry Nanog Antibody [Unconjugated]](https://images.novusbio.com/images2/Nanog_AF1997_Immunocytochemistry_6636.jpg)
![Bioactivity GDF-9 [Unconjugated]](https://images.novusbio.com/images2/GDF9_739G9CF_1211.jpg)
![Immunohistochemistry Stella/Dppa3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Stella_AF2566_Immunohistochemistry_24131.jpg)
![Bioactivity GDNF [Unconjugated]](https://images.novusbio.com/images2/GDNF_212GD_2846.jpg)
![SDS-PAGE GDNF [Unconjugated]](https://images.novusbio.com/images2/GDNF_212-GD_62.jpg)
![SEC-MALS GDNF [Unconjugated]](https://images.novusbio.com/images/212-gd_recombinant-human-gdnf-protein-sec-mals-25202393740..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")