Novus Biologicals products are now on bio-techne.com

DAP1 Recombinant Protein Antigen

Name: DAP1 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-91031PEP
Price: 279 USD

Images

There are currently no images for DAP1 Protein (NBP1-91031PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

DAP1 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DAP. Source: E. coli Amino Acid Sequence: QFRPNPTLLGNLRQNQVLCPLPYISIFKTRNSSSPNLVYGESGWMSFEDHCAPRGAISRICQDPRKILALVLFQQSP Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	DAP
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91031. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DAP1 Recombinant Protein Antigen

DAP1
DAP-1
death-associated protein 1
death-associated protein
MGC99796

Background

Death associated protein 1 (DAP-1) is a 15-kDa protein that functions as a positive mediator of cell death initiated by interferon (IFN-) gamma (1,2). DAP-1 is proline rich and possesses one SH3 binding motif, as well as several consensus protein kinase phosphorylation sites (1). It is localized to the cytoplasm, but the detailed mechanism of its pro-apoptotic function is unclear. DAP-1 and DAP kinase, a unique, 160-kDa calmodulin-dependent serine/threonine kinase, are both unique candidates for positive mediators of programmed cell death induced by IFN-gamma (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Pentraxin 2/SAP
Antibody [Unconjugate

AF2558

Simple Western Pentraxin 2/SAP Antibody [Unconjugated]

(3 Publications)

Species: Hu, Mu

Applications: Simple Western, WB

SH2D1A Antibody
(1C9)

H00004068-M01

(1 Review)

(9 Publications)

Species: Hu, Mu

Applications: ELISA, Flow, Func, WB

DAP Kinase 1
Antibody (SR1225)

NBP3-21649

Western Blot DAP Kinase 1 Antibody (SR1225)

Immunocytochemistry/ Immunofluorescence DAP Kinase 1 Antibody (SR1225)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, WB

p19ARF/CDKN2A
Antibody - BSA Free

NB200-106

Western Blot p19ARF/CDKN2A Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free

(1 Review)

(48 Publications)

Species: Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(811 Publications)

Species: Hu

Applications: BA

MGMT Antibody (MT
23.2) - BSA Free

NB100-168

Flow Cytometry MGMT Antibody (MT 23.2) - BSA Free

(21 Publications)

Species: Hu, Mu(-)

Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB

SGSM3 Antibody

NBP2-13304

Immunocytochemistry/ Immunofluorescence SGSM3 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

p53 Antibody (PAb
240) - BSA Free

NB200-103

Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free

(3 Reviews)

(42 Publications)

Species: Hu, Mu, Rt, Xp(-), Ye

Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

DPPIV/CD26
Antibody [Unconjugate

AF1180

Immunohistochemistry DPPIV/CD26 Antibody [Unconjugated]

Immunocytochemistry DPPIV/CD26 Antibody [Unconjugated]

(2 Reviews)

(56 Publications)

Species: Hu

Applications: ICC, IHC, Simple Western, WB

APRT Antibody

NBP1-89519

Immunocytochemistry/ Immunofluorescence APRT Antibody

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, PLA, WB

DAPK3/ZIPK
Antibody - BSA Free

NBP1-76962

(1 Publication)

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, WB

RASSF1 Antibody
(OTI2B11)

NBP2-03644

Immunohistochemistry-Paraffin RASSF1 Antibody (OTI2B11)

(1 Publication)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

E-Cadherin
Antibody [Unconjugate

AF748

Immunohistochemistry E-Cadherin Antibody [Unconjugated]

(142 Publications)

Species: Hu, Mu

Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB

Calmodulin 2
Antibody

NBP2-14871

(1 Publication)

Species: Mu, Rt

Applications: ICC/IF, WB

Calmodulin
Antibody (2D1) - BSA

NB120-2860

(3 Publications)

Species: Ba, Bv, Ch, Hu, Mu, Rt

Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

Calmodulin 3
Antibody

NBP2-15669

Immunohistochemistry Whole-Mount Calmodulin 3 Antibody

(1 Publication)

Species: Mu, Rt, Ze

Applications: IHC-WhMt, IHC, WB

NOD2 Antibody
(2D9) - BSA Free

NB100-524

Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free

(1 Review)

(26 Publications)

Species: Hu, Mu

Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

DAP1 Recombinant
Protein Antigen

NBP1-91031PEP

Species: Hu

Applications: AC

Publications for DAP1 Protein (NBP1-91031PEP) (0)

There are no publications for DAP1 Protein (NBP1-91031PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DAP1 Protein (NBP1-91031PEP) (0)

There are no reviews for DAP1 Protein (NBP1-91031PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DAP1 Protein (NBP1-91031PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DAP1 Products

Research Areas for DAP1 Protein (NBP1-91031PEP)

Find related products by research area.

Blogs on DAP1

There are no specific blogs for DAP1, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our DAP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

DAP

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

DAP1 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

DAP1 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for DAP1 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for DAP1 Protein (NBP1-91031PEP) (0)

Reviews for DAP1 Protein (NBP1-91031PEP) (0)

FAQs for DAP1 Protein (NBP1-91031PEP) (0)

Additional DAP1 Products

Research Areas for DAP1 Protein (NBP1-91031PEP)

Blogs on DAP1

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics