Novus Biologicals products are now on bio-techne.com

DAN/NBL1 Recombinant Protein Antigen

Name: DAN/NBL1 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-85340PEP
Price: 279 USD

Images

There are currently no images for DAN/NBL1 Protein (NBP1-85340PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

DAN/NBL1 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NBL1. Source: E. coli Amino Acid Sequence: PPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	NBL1
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85340. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	34 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DAN/NBL1 Recombinant Protein Antigen

DAN domain family member 1
DAN
DAND1
MGC8972
NBL1
neuroblastoma suppressor of tumorigenicity 1
neuroblastoma, suppression of tumorigenicity 1
Protein N03
suppression of tumorigenicity 1
Zinc finger protein DAN

Background

NBL1 product is the founding member of the evolutionarily conserved CAN (Cerberus and DAN) family of proteins, which contain a domain resembling the CTCK (C-terminal cystine knot-like) motif found in a number of signaling molecules. These proteins are secreted, and act as BMP (bone morphogenetic protein) antagonists by binding to BMPs and preventing them from interacting with their receptors. They may thus play an important role during growth and development. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

HAI-2/SPINT2
Antibody [Unconjugate

AF1107

(3 Publications)

Species: Mu

Applications: IHC, WB

Histatin 3
Antibody (4G9)

H00003347-M01

Immunocytochemistry/ Immunofluorescence Histatin 3 Antibody (4G9)

(1 Publication)

Species: Hu

Applications: ELISA, ICC/IF, S-ELISA, WB

CD55/DAF Antibody
[Unconjugated]

AF2009

Immunocytochemistry CD55/DAF Antibody [Unconjugated]

(8 Publications)

Species: Hu

Applications: ICC, IHC

n-Myc Antibody
(NMYC-1) - BSA Free

NB200-109

Immunocytochemistry/ Immunofluorescence n-Myc Antibody (NMYC-1) - BSA Free

(6 Publications)

Species: Hu, Mu

Applications: ChIP, ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB

CD21 Antibody
(SC0681)

NBP2-67605

Immunohistochemistry-Paraffin CD21 Antibody (SC0681)

(1 Publication)

Species: Hu, Pm, Mu

Applications: ICC/IF, IHC, IHC-P, IP, ISH, WB

Calretinin Antibody

NBP1-88220

Immunohistochemistry-Paraffin Calretinin Antibody

(1 Review)

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, KD, WB

DHRS4 Antibody

NBP2-98675

Species: Hu

Applications: IHC-P, IP, WB

CRIPTO Antibody
[Unconjugated]

AF1538

(4 Publications)

Species: Mu

Applications: Block, ICC, WB

PMEL17/SILV
Antibody (HMB45)

NBP2-44520

Immunohistochemistry PMEL17/SILV Antibody (HMB45)

(8 Publications)

Species: Ca(-), Hu, Rt(-)

Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB

Siglec-1/CD169
Antibody (HSn 7D2) - ...

NB600-534

Immunohistochemistry-Paraffin Siglec-1/CD169 Antibody (HSn 7D2) - BSA Free

Flow Cytometry Siglec-1/CD169 Antibody (HSn 7D2) - BSA Free

(1 Review)

(23 Publications)

Species: Hu, Mu, Po, V-Vi

Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, In vivo, RIA, WB

SI
Sucrase-Isomaltase An

NBP1-87581

(1 Publication)

Species: Hu

Applications: IHC, IHC-P, WB

Chromogranin C
Antibody

NBP2-15895

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

PML Protein
Antibody - BSA Free

NB100-59787

Immunohistochemistry PML Protein Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence PML Protein Antibody - BSA Free

(1 Review)

(42 Publications)

Species: Hu, Mu

Applications: Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, PLA, WB

RB1 Antibody
(607121) [Unconjugate

MAB6495

Immunocytochemistry RB1 Antibody (607121) [Unconjugated]

Simple Western RB1 Antibody (607121) [Unconjugated]

(5 Publications)

Species: Hu

Applications: ICC, Simple Western, WB

SSB Antibody
(OTI2C8)

NBP1-48002

Immunohistochemistry-Paraffin SSB Antibody (OTI2C8)

Species: Ca, Hu, Pm, Pm

Applications: ICC/IF, IHC, IHC-P, IP, WB

Gremlin 1 Antibody
[Unconjugated]

AF956

(1 Review)

(17 Publications)

Species: Hu, Mu

Applications: Block, IHC

PRDC/GREM2 Antibody

AF2069

(3 Publications)

Species: Mu

Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB

TrkA Antibody
[Unconjugated]

AF1056

Western Blot TrkA Antibody [Unconjugated]

(44 Publications)

Species: Rt

Applications: IHC, WB

Publications for DAN/NBL1 Protein (NBP1-85340PEP) (0)

There are no publications for DAN/NBL1 Protein (NBP1-85340PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DAN/NBL1 Protein (NBP1-85340PEP) (0)

There are no reviews for DAN/NBL1 Protein (NBP1-85340PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DAN/NBL1 Protein (NBP1-85340PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DAN/NBL1 Products

Research Areas for DAN/NBL1 Protein (NBP1-85340PEP)

Find related products by research area.

Cell Cycle and Replication

Blogs on DAN/NBL1

There are no specific blogs for DAN/NBL1, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western Blot: PML Protein Antibody [NB100-59787] - PML-RARa is a HIF-I+-transcriptional co-activator. HEK-293 cells transfected with stable mutants of HIF-1I+-or HIF-2I+-and increasing concentrations of PML-RARI+-. Image collected and cropped by Citeab from the following publication (HIF factors cooperate with PML-RAR +/- to promote acute promyelocytic leukemia progression and relapse. EMBO Mol Med (2014)) licensed under a CC-BY license.

PML Protein Antibody - BSA Free
NB100-59787

Immunohistochemistry-Frozen: Siglec-1/CD169 Antibody (HSn 7D2) [NB600-534] - Adult mouse small intestine. NB600-534 Siglec-1 was used at 1:500 and labeled with Alexa Fluor 568 conjugated secondary antibody (Red). DAPI shown as blue. Image from verified customer review.

Siglec-1/CD169 Antibody (HSn 7D2) - BSA Free
NB600-534

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our DAN/NBL1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

NBL1

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

DAN/NBL1 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

DAN/NBL1 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for DAN/NBL1 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for DAN/NBL1 Protein (NBP1-85340PEP) (0)

Reviews for DAN/NBL1 Protein (NBP1-85340PEP) (0)

FAQs for DAN/NBL1 Protein (NBP1-85340PEP) (0)

Additional DAN/NBL1 Products

Research Areas for DAN/NBL1 Protein (NBP1-85340PEP)

Blogs on DAN/NBL1

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics