![Immunohistochemistry-Paraffin: Creatine Kinase BB Antibody [NBP1-84460] - Analysis in human cerebral cortex and liver tissues. Corresponding Creatine Kinase BB RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Creatine-Kinase-BB-Antibody-Immunohistochemistry-Paraffin-NBP1-84460-img0012.jpg "Immunohistochemistry-Paraffin: Creatine Kinase BB Antibody [NBP1-84460] - Analysis in human cerebral cortex and liver tissues. Corresponding Creatine Kinase BB RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK |
| Predicted Species | Mouse (99%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CKB |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Choline Kinase beta [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Choline Kinase beta [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
Research Areas for Creatine Kinase BB Antibody (NBP1-84460)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: Creatine Kinase BB Antibody [NBP1-84460] - Immunofluorescent staining of human cell line HEK 293 shows localization to cytosol.](http://images.novusbio.com/fullsize/Creatine-Kinase-BB-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84460-img0007.jpg "Immunocytochemistry/Immunofluorescence: Creatine Kinase BB Antibody [NBP1-84460] - Immunofluorescent staining of human cell line HEK 293 shows localization to cytosol.")
![Immunohistochemistry-Paraffin: Creatine Kinase BB Antibody [NBP1-84460] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.](http://images.novusbio.com/fullsize/Creatine-Kinase-BB-Antibody-Immunohistochemistry-Paraffin-NBP1-84460-img0016.jpg "Immunohistochemistry-Paraffin: Creatine Kinase BB Antibody [NBP1-84460] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.")
![Immunohistochemistry-Paraffin: Creatine Kinase BB Antibody [NBP1-84460] - Staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in astrocytes.](http://images.novusbio.com/fullsize/Creatine-Kinase-BB-Antibody-Immunohistochemistry-Paraffin-NBP1-84460-img0013.jpg "Immunohistochemistry-Paraffin: Creatine Kinase BB Antibody [NBP1-84460] - Staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in astrocytes.")
![Immunohistochemistry-Paraffin: Creatine Kinase BB Antibody [NBP1-84460] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Creatine-Kinase-BB-Antibody-Immunohistochemistry-Paraffin-NBP1-84460-img0014.jpg "Immunohistochemistry-Paraffin: Creatine Kinase BB Antibody [NBP1-84460] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: Creatine Kinase BB Antibody [NBP1-84460] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Creatine-Kinase-BB-Antibody-Immunohistochemistry-Paraffin-NBP1-84460-img0015.jpg "Immunohistochemistry-Paraffin: Creatine Kinase BB Antibody [NBP1-84460] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.")
![Western Blot Creatine Kinase, Muscle/CKMM Antibody (492731) [Unconjugated]](https://images.novusbio.com/images2/Creatine_Kinase_MM_MAB5564_Western_Blot_20487.jpg)
![Simple Western Creatine Kinase, Muscle/CKMM Antibody (492731) [Unconjugated]](https://images.novusbio.com/images2/Creatine_Kinase_MM_MAB5564_Simple_Western_20572.jpg)
![Bioactivity GM-CSF [Unconjugated]](https://images.novusbio.com/images/protein/7954-gmcf_recombinant-human-gm-csf-cho-expressed-protein-cf-bioactivity-272020121514.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")