![Immunohistochemistry-Paraffin: CPA3 Antibody [NBP1-86130] - Analysis in human small intestine and skeletal muscle tissues. Corresponding CPA3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CPA3-Antibody-Immunohistochemistry-Paraffin-NBP1-86130-img0007.jpg "Immunohistochemistry-Paraffin: CPA3 Antibody [NBP1-86130] - Analysis in human small intestine and skeletal muscle tissues. Corresponding CPA3 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RFDREKVFRVKPQDEKQADIIKDLAKTNELDFWYPGATHHVAANMMVDFRVSEKESQAIQSALDQNKMHYEILIHDLQEEIEKQFDVKEDIPGRHSYAKYNNWEKIVAWTEKMMDKYPEMVSRIKIGSTVEDNPLYVLKIGEKNER |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CPA3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Carboxypeptidase A4/CPA4 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Carboxypeptidase A4/CPA4 [Unconjugated]")
![Simple Western CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Simple_Western_17480.jpg)
![Western Blot CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Western_Blot_18637.jpg)
![Immunohistochemistry CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/SCF_R_AF1356_Immunohistochemistry_9746.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CPA3 |
![Immunohistochemistry-Paraffin: CPA3 Antibody [NBP1-86130] - Staining of human cervix, uterine, skeletal muscle, skin and small intestine using Anti-CPA3 antibody NBP1-86130 (A) shows similar protein distribution across tissues to independent antibody NBP1-86117 (B).](http://images.novusbio.com/fullsize/CPA3-Antibody-Immunohistochemistry-Paraffin-NBP1-86130-img0006.jpg "Immunohistochemistry-Paraffin: CPA3 Antibody [NBP1-86130] - Staining of human cervix, uterine, skeletal muscle, skin and small intestine using Anti-CPA3 antibody NBP1-86130 (A) shows similar protein distribution across tissues to independent antibody NBP1-86117 (B).")
![Immunohistochemistry-Paraffin: CPA3 Antibody [NBP1-86130] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in mast cells.](http://images.novusbio.com/fullsize/CPA3-Antibody-Immunohistochemistry-Paraffin-NBP1-86130-img0011.jpg "Immunohistochemistry-Paraffin: CPA3 Antibody [NBP1-86130] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in mast cells.")
![Immunohistochemistry-Paraffin: CPA3 Antibody [NBP1-86130] - Staining of human skeletal muscle shows very weak positivity in myocytes as expected.](http://images.novusbio.com/fullsize/CPA3-Antibody-Immunohistochemistry-Paraffin-NBP1-86130-img0008.jpg "Immunohistochemistry-Paraffin: CPA3 Antibody [NBP1-86130] - Staining of human skeletal muscle shows very weak positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: CPA3 Antibody [NBP1-86130] - Staining of human cervix, uterine shows moderate to strong cytoplasmic positivity in mast cells.](http://images.novusbio.com/fullsize/CPA3-Antibody-Immunohistochemistry-Paraffin-NBP1-86130-img0009.jpg "Immunohistochemistry-Paraffin: CPA3 Antibody [NBP1-86130] - Staining of human cervix, uterine shows moderate to strong cytoplasmic positivity in mast cells.")
![Immunohistochemistry-Paraffin: CPA3 Antibody [NBP1-86130] - Staining of human skin shows moderate to strong cytoplasmic positivity in mast cells.](http://images.novusbio.com/fullsize/CPA3-Antibody-Immunohistochemistry-Paraffin-NBP1-86130-img0010.jpg "Immunohistochemistry-Paraffin: CPA3 Antibody [NBP1-86130] - Staining of human skin shows moderate to strong cytoplasmic positivity in mast cells.")
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/CCL2_DCP00_ELISA_67.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/DATA_CCL2_DCP00_ELISA_633.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/DATA_CCL2_DCP00_ELISA_634.jpg)
![Western Blot Chymase/CMA1/Mast Cell Chymase Antibody (422818) [Unconjugated]](https://images.novusbio.com/images2/Chymase_MAB4099_Western_Blot_21236.jpg)
![ELISA Chymase/CMA1/Mast Cell Chymase Antibody (422818) [Unconjugated]](https://images.novusbio.com/images2/mab4099_human-chymase-cma1-mab-clone-422818-elisa-6122021135313.jpg)
![Neutralization CCL7/MCP-3/MARC Antibody [Unconjugated]](https://images.novusbio.com/images2/CCL7_AF-456-NA_Block_Neutralize_8722.jpg)
![SDS-PAGE IL-3 [Unconjugated]](https://images.novusbio.com/images2/IL-3_203-IL_345.jpg)
![Bioactivity IL-3 [Unconjugated]](https://images.novusbio.com/images2/IL-3_203-IL_347.jpg)
![SEC-MALS IL-3 [Unconjugated]](https://images.novusbio.com/images/203-il_recombinant-human-il-3-protein-sec-mals-133202482656..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")