Home » Complement Factor I » Complement Factor I Proteins » Complement Factor I Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Complement Factor I Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Complement Factor I Protein (NBP1-88267PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Complement Factor I Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CFI.

Source: E. coli

Amino Acid Sequence: ETSLAECTFTKRRTMGYQDFADVVCYTQKADSPMDDFFQCVNGKYISQMKACDGINDCGDQSDELCCKACQGKGFHCKSGVCIPSQYQCNGEVDCITGEDEVGCAGFASVAQEETEILTADMDAERRRIKSLLPKLSC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CFI
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88267.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Complement Factor I Recombinant Protein Antigen

  • AHUS3
  • C3b Inactivator
  • C3B/C4B inactivator
  • C3BINA
  • C3b-inactivator
  • CFI
  • complement component I
  • complement control protein factor I
  • complement factor I heavy chain
  • Complement Factor I
  • EC 3.4.21
  • EC 3.4.21.45
  • FIC3b-INA
  • I factor (complement)
  • IF
  • KAF
  • Konglutinogen-activating factor
  • light chain of factor I

Background

Factor I is a plasma protein of molecular weight 88 kDa, consisting of two disulphide linked chains of 50 and 38 kDa. Factor I is a serine protease with a high degree of specificity for C3b and C4b. It has a requirement for protein cofactors for cleavage of these complement proteins, Factor H, CR1 or MCP are required for C3b cleavage and C4bp or CR1 for C4b cleavage.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Complement Factor
H Antibody [Unconjuga ...
AF4779
Immunohistochemistry Complement Factor H Antibody [Unconjugated]
(1 Review)
(2 Publications)
Species: Hu
Applications: IHC, WB
Complement C3
Antibody (11H9) - BSA ...
NB200-540
Flow Cytometry Complement C3 Antibody (11H9) - BSA Free
Immunocytochemistry/ Immunofluorescence Complement C3 Antibody (11H9) - BSA Free
Immunohistochemistry-Paraffin Complement C3 Antibody (11H9) - BSA Free
(2 Reviews)
(31 Publications)
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Band 3 Antibody
NBP2-49409
Immunohistochemistry Band 3 Antibody
Immunohistochemistry-Paraffin Band 3 Antibody
Immunohistochemistry-Paraffin Band 3 Antibody
Species: Hu
Applications: IHC, IHC-P
Biliverdin
Reductase B/BLVRB Ant
NBP1-83435
Immunohistochemistry-Paraffin Biliverdin Reductase B/BLVRB Antibody
Immunohistochemistry-Paraffin Biliverdin Reductase B/BLVRB Antibody
Immunohistochemistry-Paraffin Biliverdin Reductase B/BLVRB Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CD46 Antibody
(344519) [Unconjugate
MAB2005
N/A CD46 Antibody (344519) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, WB
Complement Factor
B Antibody
NBP1-89985
Immunocytochemistry/ Immunofluorescence Complement Factor B Antibody
Immunohistochemistry-Paraffin Complement Factor B Antibody
Immunohistochemistry-Paraffin Complement Factor B Antibody
(7 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Complement C4b/d
Antibody (16D2)
NB200-541
Western Blot Complement C4b/d Antibody (16D2)
(12 Publications)
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Complement
Component C5a [Biotin
DY2037
N/A Complement Component C5a [Biotin]
(27 Publications)
Species: Hu
Applications: ELISA
Complement
Component C2 Antibody ...
AF1936
Complement Component C2 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: IP, WB
CD35 Antibody (E11)
NBP2-29460
Immunohistochemistry-Paraffin CD35 Antibody (E11)
(6 Publications)
Species: Pm, Pm-Cm, Hu, Pm, RM
Applications: Flow, ICC/IF, IHC, IHC-P, ISH
Complement C4
Antibody
NBP3-12295
Immunohistochemistry-Paraffin Complement C4 Antibody
Immunohistochemistry-Paraffin Complement C4 Antibody
Immunohistochemistry-Paraffin Complement C4 Antibody
Species: Hu, Pm, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
CapG Antibody
NBP1-90214
Immunocytochemistry/ Immunofluorescence CapG Antibody
Western Blot CapG Antibody
Immunohistochemistry-Paraffin CapG Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
hnRNP C1 + C2
Antibody (CL2593)
NBP2-36776
Western Blot hnRNP C1 + C2 Antibody (CL2593)
Immunohistochemistry hnRNP C1 + C2 Antibody (CL2593)
Immunohistochemistry hnRNP C1 + C2 Antibody (CL2593)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(663 Publications)
Species: Mu
Applications: ELISA
SLC22A12 Antibody
(2B5)
H00116085-M02
Western Blot SLC22A12 Antibody (2B5)
ELISA SLC22A12 Antibody (2B5)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Complement C4
Antibody
NBP3-12295
Immunohistochemistry-Paraffin Complement C4 Antibody
Immunohistochemistry-Paraffin Complement C4 Antibody
Immunohistochemistry-Paraffin Complement C4 Antibody
Species: Hu, Pm, Rt
Applications: ELISA, IHC, IHC-P, IP, WB

Publications for Complement Factor I Protein (NBP1-88267PEP) (0)

There are no publications for Complement Factor I Protein (NBP1-88267PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Complement Factor I Protein (NBP1-88267PEP) (0)

There are no reviews for Complement Factor I Protein (NBP1-88267PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Complement Factor I Protein (NBP1-88267PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Complement Factor I Products

Blogs on Complement Factor I

There are no specific blogs for Complement Factor I, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Complement Factor I Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CFI