Novus Biologicals products are now on bio-techne.com

Recombinant Human COL4A6 GST (N-Term) Protein

Name: Recombinant Human COL4A6 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00001288-P02
Price: 569 USD

Submit a Review

Images

(

Enlarge)

12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human COL4A6 GST (N-Term) Protein Summary

Description	A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-51 of Human COL4A6 Source: Wheat Germ (in vitro) Amino Acid Sequence: GEKSYGKPCGGQDCSGSCQCFPEKGARHNLQLLNDMAGRLYHFSEVLPNLF
Preparation Method	in vitro wheat germ expression system
Details of Functionality	This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source	Wheat germ
Protein/Peptide Type	Recombinant Protein
Gene	COL4A6
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	ELISA Immunoaffinity Purification Protein Array Western Blot
Theoretical MW	31.35 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -80C. Avoid freeze-thaw cycles.
Buffer	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human COL4A6 GST (N-Term) Protein

collagen alpha 6 type IV
collagen alpha-6(IV) chain
collagen IV, alpha-6 polypeptide
collagen of basement membrane, alpha-6
collagen, type IV, alpha 6
CXDELq22.3
DELXq22.3
dJ889N15.4 (Collagen Alpha 6(IV))
EC 2.7.7.8
MGC88184

Background

COL4A6( AAH05305, 23 a.a. - 74 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Collagen IV alpha5
Antibody

NBP3-41417

Species: Hu, Mu, Po, Rt

Applications: WB

Collagen IV alpha4
Antibody

NBP3-43374

Species: Hu

Applications: ICC/IF, IHC, IP, WB

Tumstatin/COL4A3
Antibody - Azide and ...

NBP3-02967

Immunocytochemistry/ Immunofluorescence Tumstatin/COL4A3 Antibody - Azide and BSA Free

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, WB

COL4A2 Antibody

NBP3-41311

Species: Hu, Mu

Applications: ICC/IF, IHC, WB

EDAR Antibody
[Unconjugated]

AF745

(6 Publications)

Species: Mu

Applications: Block, WB

Collagen IV
Antibody

NB120-6586

(7 Reviews)

(43 Publications)

Species: Bv, Fe, Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KO, SR Microscopy, WB

Collagen I Antibody

NB600-408

(16 Reviews)

(322 Publications)

Species: Bv, Hu, Mu, Po, Rb, Rt

Applications: ELISA, FLISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, MiAr, PAGE, WB

Desmin Antibody
[Unconjugated]

AF3844

Immunocytochemistry/ Immunofluorescence Desmin Antibody [Unconjugated]

(2 Reviews)

(34 Publications)

Species: Hu, Mu

Applications: IHC

PLOD1 Antibody

NBP2-38770

(3 Publications)

Species: Hu, Mu

Applications: IHC-P, WB

Doublecortin
Antibody

NBP1-72042

Immunocytochemistry/ Immunofluorescence Doublecortin Antibody

(5 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB

Steroid sulfatase
Antibody

NBP1-90095

(3 Publications)

Species: Hu

Applications: IHC, IHC-P

Myelin PLP Antibody

NBP1-87781

(1 Review)

(5 Publications)

Species: Hu, Mu

Applications: IHC, IHC-P, WB

Calpain 6 Antibody
- BSA Free

NBP1-76937

Immunohistochemistry Calpain 6 Antibody - BSA Free

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Filamin A Antibody
(4E10-1B2)

H00002316-M01

Proximity Ligation Assay Filamin A Antibody (4E10-1B2)

(14 Publications)

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB

CD34 Antibody
[Unconjugated]

AF4117

(3 Reviews)

(37 Publications)

Species: Rt

Applications: IHC, WB

Radixin Antibody
(1D9)

H00005962-M06

Immunohistochemistry Radixin Antibody (1D9)

Immunocytochemistry/ Immunofluorescence Radixin Antibody (1D9)

(7 Publications)

Species: Ch, Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, WB

CCL27/CTACK [HRP]

DCC270

(10 Publications)

Species: Hu

Applications: ELISA

CD117/c-kit
Antibody [Unconjugate

AF1356

Western Blot CD117/c-kit Antibody [Unconjugated]

Immunohistochemistry CD117/c-kit Antibody [Unconjugated]

(4 Reviews)

(116 Publications)

Species: Hu, Mu

Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB

Publications for COL4A6 Recombinant Protein (H00001288-P02) (0)

There are no publications for COL4A6 Recombinant Protein (H00001288-P02).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COL4A6 Recombinant Protein (H00001288-P02) (0)

There are no reviews for COL4A6 Recombinant Protein (H00001288-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COL4A6 Recombinant Protein (H00001288-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional COL4A6 Products

Blogs on COL4A6

There are no specific blogs for COL4A6, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Balb/3T3 mouse embryonic fibroblast cell line stained with Collagen I antibody. IHC-P image submitted by a verified customer review.

Collagen I Antibody
NB600-408-0.1mg

Simple Western lane view shows lysates of MO7e human megakaryocytic leukemic cell line, P815 mouse mastocytoma cell line and MC/9-2 mouse mast cell line, loaded at 0.2 mg/mL. A specific band was detected for CD117/c-kit at approximately 150-165 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse CD117/c-kit Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1356) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.

CD117/c-kit Antibody [Unconjugated]
AF1356

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our Recombinant Human COL4A6 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol

COL4A6

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Recombinant Human COL4A6 GST (N-Term) Protein

Species Glossary

Images

Product Details

Order Details

Recombinant Human COL4A6 GST (N-Term) Protein Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Recombinant Human COL4A6 GST (N-Term) Protein

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for COL4A6 Recombinant Protein (H00001288-P02) (0)

Reviews for COL4A6 Recombinant Protein (H00001288-P02) (0)

Product General Protocols

Video Protocols

FAQs for COL4A6 Recombinant Protein (H00001288-P02) (0)

Additional COL4A6 Products

Blogs on COL4A6

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics