![Immunohistochemistry-Paraffin: COL11A1 Antibody [NBP3-04904] - Paraffin-embedded rat heart using COL11A1 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/COL11A1-Antibody-Immunohistochemistry-Paraffin-NBP3-04904-img0001.jpg "Immunohistochemistry-Paraffin: COL11A1 Antibody [NBP3-04904] - Paraffin-embedded rat heart using COL11A1 antibody at dilution of 1:100 (40x lens).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 260-430 of human COL11A1 (NP_542196.2). EKKKSNFKKKMRTVATKSKEKSKKFTPPKSEKFSSKKKKSYQASAKAKLGVKANIVDDFQEYNYGTMESYQTEAPRHVSGTNEPNPVEEIFTEEYLTGEDYDSQRKNSEDTLYENKEIDGRDSDLLVDGDLGEYDFYEYKEYEDKPTSPPNEEFGPGVPAETDITETSING |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | COL11A1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 181 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS with 50% glycerol, pH7.3. |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | COL11A1 |
![Immunohistochemistry-Paraffin: COL11A1 Antibody [NBP3-04904] - Paraffin-embedded mouse heart using COL11A1 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/COL11A1-Antibody-Immunohistochemistry-Paraffin-NBP3-04904-img0002.jpg "Immunohistochemistry-Paraffin: COL11A1 Antibody [NBP3-04904] - Paraffin-embedded mouse heart using COL11A1 antibody at dilution of 1:100 (40x lens).")
![Western Blot: COL11A1 Antibody [NBP3-04904] -Analysis of lysates from A-204 cells, using COL11A1 Rabbit pAb at 1:2000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 90s.](http://images.novusbio.com/fullsize/antibody/nbp3-04904_rabbit-polyclonal-col11a1-antibody-western-blot-317202410395..jpg "Western Blot: COL11A1 Antibody [NBP3-04904] -Analysis of lysates from A-204 cells, using COL11A1 Rabbit pAb at 1:2000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 90s.")
![N/A COMP/Thrombospondin-5 [HRP]](https://images.novusbio.com/images2/COMP_DCMP0_ELISA_66.jpg)
![N/A COMP/Thrombospondin-5 [HRP]](https://images.novusbio.com/images2/DATA_COMP_DCMP0_ELISA_632.jpg)
![N/A MMP-13 [HRP]](https://images.novusbio.com/images2/MMP-13_DM1300_ELISA_136.jpg)
![N/A MMP-13 [HRP]](https://images.novusbio.com/images2/DATA_MMP13_DM1300_ELISA_751.jpg)
![Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0](https://images.novusbio.com/images2/Versican_AF3054_Immunocytochemistry_6488.jpg)
![Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0](https://images.novusbio.com/images2/af3054_human-versican-affinity-purified-polyclonal-ab-immunocytochemistry-842022131824.jpg)
![Immunocytochemistry/ Immunofluorescence Versican Antibody [Unconjugated] - Isoform V0](https://images.novusbio.com/images/af3054_human-versican-affinity-purified-polyclonal-ab-22820241723618.jpg)
![N/A MMP-9 [HRP]](https://images.novusbio.com/images2/MMP-9_DMP900_ELISA_148.jpg)
![N/A MMP-9 [HRP]](https://images.novusbio.com/images2/DATA_MMP9_DMP900_ELISA_770.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")