Home » CLCN5 » CLCN5 Proteins » CLCN5 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CLCN5 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CLCN5 Recombinant Protein Antigen (NBP2-58621PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CLCN5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to CLCN5.

Source: E. coli

Amino Acid Sequence: MAMWQGAMDNRGFQQGSFSSFQNSSSDEDLMDIPATAMDFSMRDDVPPLDREVG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CLCN5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58621.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CLCN5 Recombinant Protein Antigen

  • chloride channel 5
  • Chloride channel protein 5
  • Chloride transporter ClC-5
  • CLC5
  • clC-5
  • CLCK2NPHL2
  • DENTSNPHL1
  • H(+)/Cl(-) exchange transporter 5
  • hCIC-K2
  • hClC-K2
  • nephrolithiasis 1 (X-linked)
  • nephrolithiasis 2, X-linked
  • XLRH
  • XRN

Background

CLCN5 encodes a member of the ClC family of chloride ion channels and ion transporters. Mutations in this gene have been found in Dent disease and renal tubular disorders complicated by nephrolithiasis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CLCN3 Antibody
(S258-5)
NBP2-59379
Immunocytochemistry/ Immunofluorescence CLCN3 Antibody (S258-5)
Western Blot CLCN3 Antibody (S258-5)
Immunocytochemistry/ Immunofluorescence CLCN3 Antibody (S258-5)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
CLCN4 Antibody
NBP1-84452
Immunohistochemistry-Paraffin CLCN4 Antibody
Immunohistochemistry-Paraffin CLCN4 Antibody
Immunohistochemistry-Paraffin CLCN4 Antibody
Species: Hu
Applications: IHC, IHC-P
CFTR Antibody
(24-1) [Unconjugated] ...
MAB25031
Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus
Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus
Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus
(10 Reviews)
(76 Publications)
Species: Hu
Applications: IHC, IP, WB
OCRL Antibody
NBP1-80973
Western Blot OCRL Antibody
Immunohistochemistry-Paraffin OCRL Antibody
Immunohistochemistry-Paraffin OCRL Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, KD, WB
Galectin-10
Antibody [Unconjugate
AF5447
Western Blot Galectin-10 Antibody [Unconjugated]
Intracellular Staining by Flow Cytometry Galectin-10 Antibody [Unconjugated]
Intracellular Staining by Flow Cytometry Galectin-10 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
CLC Antibody
(138815) [Unconjugate
MAB962
Immunohistochemistry CLC Antibody (138815) [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC, WB
CLCN2 Antibody
(3E1)
H00001181-M01
Western Blot CLCN2 Antibody (3E1)
Western Blot CLCN2 Antibody (3E1)
Sandwich ELISA CLCN2 Antibody (3E1)
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
LRP2 Antibody
(CD7D5) - Azide and B ...
NB110-96417
Immunocytochemistry/ Immunofluorescence LRP2 Antibody (CD7D5) - Azide and BSA Free
Immunohistochemistry LRP2 Antibody (CD7D5) - Azide and BSA Free
Immunohistochemistry-Paraffin LRP2 Antibody (CD7D5) - Azide and BSA Free
(1 Review)
(20 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
CLCN7 Antibody -
BSA Free
NBP2-92800
Western Blot CLCN7 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: WB
CLCNKB Antibody
NBP3-10348
Western Blot CLCNKB Antibody
Species: Hu
Applications: WB
CLCN1 Antibody -
BSA Free
NBP2-92461
Immunohistochemistry-Paraffin CLCN1 Antibody - BSA Free
Western Blot CLCN1 Antibody - BSA Free
Immunohistochemistry-Paraffin CLCN1 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
PTH Antibody
(918462) [Unconjugate
MAB7665
Immunohistochemistry PTH Antibody (918462) [Unconjugated]
Western Blot PTH Antibody (918462) [Unconjugated]
Species: Hu
Applications: IHC, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
CLCN6 Antibody
(2H2)
H00001185-M05
ELISA CLCN6 Antibody (2H2)
Immunocytochemistry/ Immunofluorescence CLCN6 Antibody (2H2)
Species: Hu
Applications: ELISA, ICC/IF, WB
CLCNKA Antibody -
Azide and BSA Free
NBP2-92433
Western Blot CLCNKA Antibody - Azide and BSA Free
Species: Hu, Mu
Applications: WB
NT-proBNP Antibody
(OTI11G4)
NBP2-46201
Western Blot NT-proBNP Antibody (OTI11G4)
Immunohistochemistry NT-proBNP Antibody (OTI11G4)
Immunohistochemistry NT-proBNP Antibody (OTI11G4)
(1 Review)
Species: Hu
Applications: IHC, IHC-P, WB
Cubilin Antibody
[Unconjugated]
AF3700
Immunohistochemistry Cubilin Antibody [Unconjugated]
Western Blot Cubilin Antibody [Unconjugated]
Simple Western Cubilin Antibody [Unconjugated]
(1 Review)
(7 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NHE3/SLC9A3
Antibody
NBP1-82574
Immunohistochemistry-Paraffin NHE3/SLC9A3 Antibody
Immunohistochemistry-Paraffin NHE3/SLC9A3 Antibody
Immunohistochemistry-Paraffin NHE3/SLC9A3 Antibody
(31 Publications)
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PAGE, WB
SLC26A4 Antibody
NBP1-85237
Immunohistochemistry-Paraffin SLC26A4 Antibody
Immunohistochemistry-Frozen SLC26A4 Antibody
Immunohistochemistry-Paraffin SLC26A4 Antibody
(1 Review)
(2 Publications)
Species: Hu
Applications: IHC, IHC-Fr, IHC-P
CLCN5 Recombinant
Protein Antigen
NBP2-58621PEP
CLCN5 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for CLCN5 Recombinant Protein Antigen (NBP2-58621PEP) (0)

There are no publications for CLCN5 Recombinant Protein Antigen (NBP2-58621PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLCN5 Recombinant Protein Antigen (NBP2-58621PEP) (0)

There are no reviews for CLCN5 Recombinant Protein Antigen (NBP2-58621PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CLCN5 Recombinant Protein Antigen (NBP2-58621PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CLCN5 Products

Research Areas for CLCN5 Recombinant Protein Antigen (NBP2-58621PEP)

Find related products by research area.

Blogs on CLCN5

There are no specific blogs for CLCN5, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CLCN5 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CLCN5