Novus Biologicals products are now on bio-techne.com

CLCN5 Recombinant Protein Antigen

Name: CLCN5 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-84451PEP
Price: 279 USD

Images

There are currently no images for CLCN5 Protein (NBP1-84451PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CLCN5 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CLCN5. Source: E. coli Amino Acid Sequence: EAKEEFAHKTLAMDVMKPRRNDPLLTVLTQDSMTVEDVETIISETTYSGFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVVSTSIIYFTEHSPPLPPYTPPTLKLQNILDLSPFTVTD Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	CLCN5
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84451. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	31 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CLCN5 Recombinant Protein Antigen

chloride channel 5
Chloride channel protein 5
Chloride transporter ClC-5
CLC5
clC-5
CLCK2NPHL2
DENTSNPHL1
H(+)/Cl(-) exchange transporter 5
hCIC-K2
hClC-K2
nephrolithiasis 1 (X-linked)
nephrolithiasis 2, X-linked
XLRH
XRN

Background

CLCN5 encodes a member of the ClC family of chloride ion channels and ion transporters. Mutations in this gene have been found in Dent disease and renal tubular disorders complicated by nephrolithiasis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CLCN3 Antibody
(S258-5)

NBP2-59379

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, WB

CLCN4 Antibody

NBP1-84452

Species: Hu

Applications: IHC, IHC-P

CFTR Antibody
(24-1) [Unconjugated] ...

MAB25031

Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus

(10 Reviews)

(76 Publications)

Species: Hu

Applications: IHC, IP, WB

OCRL Antibody

NBP1-80973

Immunohistochemistry-Paraffin OCRL Antibody

(1 Publication)

Species: Hu

Applications: IHC, IHC-P, KD, WB

Galectin-10
Antibody [Unconjugate

AF5447

Intracellular Staining by Flow Cytometry Galectin-10 Antibody [Unconjugated]

(2 Publications)

Species: Hu

Applications: CyTOF-ready, ICFlow, WB

CLC Antibody
(138815) [Unconjugate

MAB962

(1 Publication)

Species: Hu

Applications: IHC, WB

CLCN2 Antibody
(3E1)

H00001181-M01

Species: Hu

Applications: ELISA, KD, S-ELISA, WB

LRP2 Antibody
(CD7D5) - Azide and B ...

NB110-96417

Immunohistochemistry LRP2 Antibody (CD7D5) - Azide and BSA Free

Immunohistochemistry-Paraffin LRP2 Antibody (CD7D5) - Azide and BSA Free

(1 Review)

(20 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P

CLCN7 Antibody -
BSA Free

NBP2-92800

Species: Hu, Mu, Rt

Applications: WB

CLCNKB Antibody

NBP3-10348

Species: Hu

Applications: WB

CLCN1 Antibody -
BSA Free

NBP2-92461

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

PTH Antibody
(918462) [Unconjugate

MAB7665

Western Blot PTH Antibody (918462) [Unconjugated]

Species: Hu

Applications: IHC, WB

Albumin Antibody
(188835) [Unconjugate ...

MAB1455

Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum

Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum

(3 Reviews)

(54 Publications)

Species: Hu

Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB

CLCN6 Antibody
(2H2)

H00001185-M05

Immunocytochemistry/ Immunofluorescence CLCN6 Antibody (2H2)

Species: Hu

Applications: ELISA, ICC/IF, WB

CLCNKA Antibody -
Azide and BSA Free

NBP2-92433

Species: Hu, Mu

Applications: WB

NT-proBNP Antibody
(OTI11G4)

NBP2-46201

Immunohistochemistry NT-proBNP Antibody (OTI11G4)

(1 Review)

Species: Hu

Applications: IHC, IHC-P, WB

Cubilin Antibody
[Unconjugated]

AF3700

Western Blot Cubilin Antibody [Unconjugated]

Simple Western Cubilin Antibody [Unconjugated]

(1 Review)

(7 Publications)

Species: Hu, Mu, Rt

Applications: IHC, Simple Western, WB

NHE3/SLC9A3
Antibody

NBP1-82574

(31 Publications)

Species: Hu, Mu, Po

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PAGE, WB

SLC26A4 Antibody

NBP1-85237

Immunohistochemistry-Frozen SLC26A4 Antibody

(1 Review)

(2 Publications)

Species: Hu

Applications: IHC, IHC-Fr, IHC-P

CLCN5 Recombinant
Protein Antigen

NBP1-84451PEP

Species: Hu

Applications: AC

Publications for CLCN5 Protein (NBP1-84451PEP) (0)

There are no publications for CLCN5 Protein (NBP1-84451PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLCN5 Protein (NBP1-84451PEP) (0)

There are no reviews for CLCN5 Protein (NBP1-84451PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CLCN5 Protein (NBP1-84451PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CLCN5 Products

Research Areas for CLCN5 Protein (NBP1-84451PEP)

Find related products by research area.

Blogs on CLCN5

There are no specific blogs for CLCN5, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

CFTR was detected in immersion fixed paraffin-embedded sections of human placenta using 8 µg/mL Mouse Anti-Human CFTR C-Terminus Monoclonal Antibody (Catalog # MAB25031) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-AEC Cell & Tissue Staining Kit (red; Catalog # CTS003) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.

CFTR Antibody (24-1) [Unconjugated] - C-terminus
MAB25031

Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.

Albumin Antibody (188835) [Unconjugated] - Serum
MAB1455

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our CLCN5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

CLCN5

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

CLCN5 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

CLCN5 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for CLCN5 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for CLCN5 Protein (NBP1-84451PEP) (0)

Reviews for CLCN5 Protein (NBP1-84451PEP) (0)

FAQs for CLCN5 Protein (NBP1-84451PEP) (0)

Additional CLCN5 Products

Research Areas for CLCN5 Protein (NBP1-84451PEP)

Blogs on CLCN5

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics