CLCN4 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MVNAGAMSGSGNLMDFLDEPFPDVGTYEDFH |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CLCN4 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for CLCN4 Antibody
Background
The family of voltage-dependent chloride channels (CLCs) regulate cellular trafficking of chloride ions, a critical component of all living cells. CLCs regulate excitability in muscle and nerve cells, aid in organic solute transport and maintain cellular volume. The genes encoding human CLC-1 through CLC-7 map to chromosomes 7, 3q26, 4q32, Xp22, Xp11, 1p36 and 16p13, respectively. CLC-1 is highly expressed in skeletal muscle. Mutations in the gene encoding CLC-1 lead to myotonia, an inheritable disorder characterized by muscle stiffness and renal salt wasting. CLC-2 is highly expressed in the epithelia of several organs including lung, which suggests CLC-2 may be a possible therapeutic target for cystic fibrosis. CLC-3 expression is particularly abundant in neuronal tissue, while CLC-4 expression is evident in skeletal and cardiac muscle as well as brain. Mutations in the gene encoding CLC-5 lead to Dent's disease, a renal disorder characterized by proteinuria and hypercalciuria. CLC-6 and CLC-7 are broadly expressed in several tissues including testes, kidney, brain and muscle.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, IP, WB
Species: Hu
Applications: ICC
Species: Hu, Pm, Mu
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF
Publications for CLCN4 Antibody (NBP2-57670) (0)
There are no publications for CLCN4 Antibody (NBP2-57670).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CLCN4 Antibody (NBP2-57670) (0)
There are no reviews for CLCN4 Antibody (NBP2-57670).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CLCN4 Antibody (NBP2-57670) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CLCN4 Products
Research Areas for CLCN4 Antibody (NBP2-57670)
Find related products by research area.
|
Blogs on CLCN4