![Immunohistochemistry-Paraffin: Chromogranin B Antibody [NBP1-80782] - Analysis in human adrenal gland and liver tissues using NBP1-80782 antibody. Corresponding CHGB RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Chromogranin-B-Antibody-Immunohistochemistry-Paraffin-NBP1-80782-img0024.jpg "Immunohistochemistry-Paraffin: Chromogranin B Antibody [NBP1-80782] - Analysis in human adrenal gland and liver tissues using NBP1-80782 antibody. Corresponding CHGB RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KQYSSHHTAEKRKRLGELFNPYYDPLQWKSSHFERRDNMNDNFLEGEEENELTLNEKNFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLDQLLHYRKKSAEFPDFYDS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CHGB |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Flow Cytometry ERMAP Antibody [Unconjugated]](https://images.novusbio.com/images2/ERMAP_AF4928_Flow_Cytometry_11957.jpg)
![Neutralization Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Block_Neutralize_8779.jpg)
![Western Blot Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Western_Blot_20179.jpg)
![Immunohistochemistry Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1445_mouse-rat-prolactin-affinity-purified-polyclonal-ab-immunohistochemistry-19202393922..jpg)
![Immunohistochemistry PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Immunohistochemistry_16650.jpg)
![Western Blot PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Western_Blot_16656.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Chromogranin B Antibody (NBP1-80782)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Chromogranin B Antibody [NBP1-80782] - Staining of human adrenal gland, colon, liver and pancreas using Anti-CHGB antibody NBP1-80782 (A) shows similar protein distribution across tissues to independent antibody NBP1-80781 (B).](http://images.novusbio.com/fullsize/Chromogranin-B-Antibody-Immunohistochemistry-Paraffin-NBP1-80782-img0017.jpg "Immunohistochemistry-Paraffin: Chromogranin B Antibody [NBP1-80782] - Staining of human adrenal gland, colon, liver and pancreas using Anti-CHGB antibody NBP1-80782 (A) shows similar protein distribution across tissues to independent antibody NBP1-80781 (B).")
![Western Blot: Chromogranin B Antibody [NBP1-80782] - Analysis in human cell line SH-SY5Y.](http://images.novusbio.com/fullsize/Chromogranin-B-Antibody-Western-Blot-NBP1-80782-img0021.jpg "Western Blot: Chromogranin B Antibody [NBP1-80782] - Analysis in human cell line SH-SY5Y.")
![Immunocytochemistry/Immunofluorescence: Chromogranin B Antibody [NBP1-80782] - Staining of human cell line SH-SY5Y shows localization to vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Chromogranin-B-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80782-img0006.jpg "Immunocytochemistry/Immunofluorescence: Chromogranin B Antibody [NBP1-80782] - Staining of human cell line SH-SY5Y shows localization to vesicles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Chromogranin B Antibody [NBP1-80782] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.](http://images.novusbio.com/fullsize/Chromogranin-B-Antibody-Immunohistochemistry-Paraffin-NBP1-80782-img0018.jpg "Immunohistochemistry-Paraffin: Chromogranin B Antibody [NBP1-80782] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.")
![Immunohistochemistry-Paraffin: Chromogranin B Antibody [NBP1-80782] - Staining of human colon shows strong cytoplasmic positivity in enteroendocrine cells.](http://images.novusbio.com/fullsize/Chromogranin-B-Antibody-Immunohistochemistry-Paraffin-NBP1-80782-img0019.jpg "Immunohistochemistry-Paraffin: Chromogranin B Antibody [NBP1-80782] - Staining of human colon shows strong cytoplasmic positivity in enteroendocrine cells.")
![Immunohistochemistry-Paraffin: Chromogranin B Antibody [NBP1-80782] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Chromogranin-B-Antibody-Immunohistochemistry-Paraffin-NBP1-80782-img0020.jpg "Immunohistochemistry-Paraffin: Chromogranin B Antibody [NBP1-80782] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: Chromogranin B Antibody [NBP1-80782] - Staining of human colon shows strong cytoplasmic positivity in enteroendocrine cells.](http://images.novusbio.com/fullsize/Chromogranin-B-Antibody-Immunohistochemistry-Paraffin-NBP1-80782-img0022.jpg "Immunohistochemistry-Paraffin: Chromogranin B Antibody [NBP1-80782] - Staining of human colon shows strong cytoplasmic positivity in enteroendocrine cells.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Western_Blot_20961.jpg)
![ELISA Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_ELISA_22201.jpg)
![Neutralization Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Block_Neutralize_8751.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")