Home » CHMP5 » CHMP5 Antibodies » CHMP5 Antibody
Novus Biologicals products are now on bio-techne.com

CHMP5 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: CHMP5 Antibody [NBP2-49227] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Kidney tissue
Western Blot: CHMP5 Antibody [NBP2-49227] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Kidney tissue
Immunohistochemistry-Paraffin: CHMP5 Antibody [NBP2-49227] - Staining of human lymph node.
Immunohistochemistry-Paraffin: CHMP5 Antibody [NBP2-49227] - Staining of human kidney shows cytoplasmic positivity in renal tubules.
Independent Antibodies: Immunohistochemistry-Paraffin: CHMP5 Antibody [NBP2-49227] - Staining of human colon, kidney, liver and lymph node using Anti-CHMP5 antibody NBP2-49227 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: CHMP5 Antibody [NBP2-49227] - Staining of human kidney.
Immunohistochemistry-Paraffin: CHMP5 Antibody [NBP2-49227] - Staining of human liver.
Immunohistochemistry-Paraffin: CHMP5 Antibody [NBP2-49227] - Staining of human colon.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

        

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CHMP5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KAYKQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAELD
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHMP5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CHMP5 Recombinant Protein Antigen (NBP2-49227PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CHMP5 Antibody

  • apoptosis-related protein PNAS-2
  • C9orf83
  • charged multivesicular body protein 5
  • chromatin modifying protein 5
  • Chromatin-modifying protein 5
  • chromosome 9 open reading frame 83
  • HSPC177
  • hVps60
  • PNAS-2
  • SNF7 domain containing 2
  • SNF7 domain-containing protein 2
  • SNF7DC2
  • Vacuolar protein sorting-associated protein 60
  • Vps60CGI-34

Background

CHMP5 is a component of the ESCRT-III complex, which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-III complex is probably involved in the concentration of MVB cargo. In case of infection, the HIV-1 virus takes advantage of the ESCRT-III complex for budding and exocytic cargoes of viral proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

VPS4A Antibody
(SR2511)
NBP3-27784
Western Blot VPS4A Antibody (SR2511)
Immunohistochemistry-Paraffin VPS4A Antibody (SR2511)
Immunocytochemistry/ Immunofluorescence VPS4A Antibody (SR2511)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
VTA1 Antibody
NBP1-86745
Western Blot VTA1 Antibody
Immunohistochemistry-Paraffin VTA1 Antibody
Immunohistochemistry-Paraffin VTA1 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
CHMP2A Antibody
NBP1-91780
Immunohistochemistry-Paraffin CHMP2A Antibody
Immunohistochemistry-Paraffin CHMP2A Antibody
Immunohistochemistry-Paraffin CHMP2A Antibody
Species: Hu
Applications: IHC, IHC-P
CHMP4A Antibody
NBP2-49557
Immunohistochemistry-Paraffin CHMP4A Antibody
Species: Hu
Applications: IHC, IHC-P
CHMP4B Antibody
NBP2-87183
Immunohistochemistry-Paraffin CHMP4B Antibody
Western Blot CHMP4B Antibody
Western Blot CHMP4B Antibody
Species: Hu, Mu
Applications: IHC-P, WB
CHMP6 Antibody
NBP1-83726
Western Blot CHMP6 Antibody
Immunohistochemistry-Paraffin CHMP6 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Bag-1 Antibody
NB100-56082
Immunohistochemistry-Paraffin Bag-1 Antibody
Immunohistochemistry-Paraffin Bag-1 Antibody
Western Blot Bag-1 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
CHMP1B Antibody
NBP2-37986
Immunohistochemistry-Paraffin CHMP1B Antibody
Immunohistochemistry-Paraffin CHMP1B Antibody
Immunohistochemistry-Paraffin CHMP1B Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
VPS24 Antibody
(SR1492)
NBP3-22183
Western Blot VPS24 Antibody (SR1492)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IP, WB
APAF-1 Antibody
(94408)
MAB868
Western Blot APAF-1 Antibody (94408)
(8 Publications)
Species: Hu
Applications: WB
TGF-beta RI/ALK-5
Antibody [Unconjugate ...
AF3025
Western Blot TGF-beta RI/ALK-5 Antibody [Unconjugated]
Immunocytochemistry TGF-beta RI/ALK-5 Antibody [Unconjugated]
Western Blot TGF-beta RI/ALK-5 Antibody [Unconjugated]
(16 Publications)
Species: Hu
Applications: ELISA, ICC, WB
Tau Antibody (2E9)
NBP2-25162
Immunocytochemistry/ Immunofluorescence Tau Antibody (2E9)
Western Blot Tau Antibody (2E9)
Immunocytochemistry/ Immunofluorescence Tau Antibody (2E9)
(5 Publications)
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB
14-3-3 Antibody
NBP2-27202
Simple Western 14-3-3 Antibody
Immunocytochemistry/ Immunofluorescence 14-3-3 Antibody
Western Blot 14-3-3 Antibody
(1 Review)
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
Alix Antibody
NBP1-90201
Western Blot Alix Antibody
Immunocytochemistry/ Immunofluorescence Alix Antibody
Immunohistochemistry-Paraffin Alix Antibody
(1 Review)
(10 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
NDUFB6 Antibody
NBP1-92172
Immunohistochemistry-Paraffin NDUFB6 Antibody
Western Blot NDUFB6 Antibody
Immunocytochemistry/ Immunofluorescence NDUFB6 Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TSG101 Antibody
(4A10)
NB200-112
Western Blot TSG101 Antibody (4A10)
Immunohistochemistry-Paraffin TSG101 Antibody (4A10)
Immunohistochemistry-Paraffin TSG101 Antibody (4A10)
(2 Reviews)
(100 Publications)
Species: Ca, Ha, Hu, Pm, Mu, Po, Rt, Ze
Applications: EM, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, IP, KD, WB
ISG15/UCRP
[7-Amino-4-Methyl Cou
UL-553
ISG15/UCRP [7-Amino-4-Methyl Coumarin]
(12 Publications)
Species: Hu
Applications: EnzAct

Publications for CHMP5 Antibody (NBP2-49227) (0)

There are no publications for CHMP5 Antibody (NBP2-49227).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHMP5 Antibody (NBP2-49227) (0)

There are no reviews for CHMP5 Antibody (NBP2-49227). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CHMP5 Antibody (NBP2-49227) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CHMP5 Products

Research Areas for CHMP5 Antibody (NBP2-49227)

Find related products by research area.

Blogs on CHMP5

There are no specific blogs for CHMP5, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHMP5 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CHMP5