![Immunocytochemistry/Immunofluorescence: CEP164 Antibody [NBP1-81445] - Fetuin-A inhibits ciliogenesis. Primary cilia were examined in the absence (CTL) or presence of fetuin-A (FA) by immunostaining with antibodies against acetylated tubulin (Ace-tub), Cep164, IFT88, or Arl13b. Image collected and cropped by CiteAb from the following publication (//www.mdpi.com/1422-0067/20/20/5207), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/CEP164-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81445-img0014.jpg "Immunocytochemistry/Immunofluorescence: CEP164 Antibody [NBP1-81445] - Fetuin-A inhibits ciliogenesis. Primary cilia were examined in the absence (CTL) or presence of fetuin-A (FA) by immunostaining with antibodies against acetylated tubulin (Ace-tub), Cep164, IFT88, or Arl13b. Image collected and cropped by CiteAb from the following publication (//www.mdpi.com/1422-0067/20/20/5207), licensed under a CC-BY license.")
| Reactivity | Hu, Mu, ZeSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DASQELEISEHMKEPQLSDSIASDPKSFHGLDFGFRSRISEHLLDVDVLSPVLGGACRQAQQPLGIEDKDDSQSSQDELQSKQSKGLEERLSPPLPHE |
| Marker | Centriole Appendage Marker |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CEP164 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CEP164 Antibody (NBP1-81445)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: CEP164 Antibody [NBP1-81445] - Staining of human fallopian tube shows strong positivity in cilia in glandular cells.](http://images.novusbio.com/fullsize/CEP164-Antibody-Immunohistochemistry-Paraffin-NBP1-81445-img0012.jpg "Immunohistochemistry-Paraffin: CEP164 Antibody [NBP1-81445] - Staining of human fallopian tube shows strong positivity in cilia in glandular cells.")
![Immunocytochemistry/Immunofluorescence: CEP164 Antibody [NBP1-81445] - Staining of human cell line U-2 OS shows localization to centrosome. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CEP164-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81445-img0007.jpg "Immunocytochemistry/Immunofluorescence: CEP164 Antibody [NBP1-81445] - Staining of human cell line U-2 OS shows localization to centrosome. Antibody staining is shown in green.")
![Immunocytochemistry/Immunofluorescence: CEP164 Antibody [NBP1-81445] - CEP295 overexpression induces extra-long microtubule-based filaments with low efficiency. Schematics on right of D indicate centrioles (black rectangles) and positions of CEP164 (red squares). MC, mother centriole; DC, daughter centriole. Image collected and cropped by CiteAb from the following publication (//jcs.biologists.org/lookup/doi/10.1242/jcs.186338), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/CEP164-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81445-img0013.jpg "Immunocytochemistry/Immunofluorescence: CEP164 Antibody [NBP1-81445] - CEP295 overexpression induces extra-long microtubule-based filaments with low efficiency. Schematics on right of D indicate centrioles (black rectangles) and positions of CEP164 (red squares). MC, mother centriole; DC, daughter centriole. Image collected and cropped by CiteAb from the following publication (//jcs.biologists.org/lookup/doi/10.1242/jcs.186338), licensed under a CC-BY license.")
![Immunohistochemistry-Paraffin: CEP164 Antibody [NBP1-81445] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/CEP164-Antibody-Immunohistochemistry-Paraffin-NBP1-81445-img0008.jpg "Immunohistochemistry-Paraffin: CEP164 Antibody [NBP1-81445] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: CEP164 Antibody [NBP1-81445] - Staining of human bronchus shows moderate to strong positivity in cilia in respiratory epithelial cells.](http://images.novusbio.com/fullsize/CEP164-Antibody-Immunohistochemistry-Paraffin-NBP1-81445-img0009.jpg "Immunohistochemistry-Paraffin: CEP164 Antibody [NBP1-81445] - Staining of human bronchus shows moderate to strong positivity in cilia in respiratory epithelial cells.")
![Immunohistochemistry-Paraffin: CEP164 Antibody [NBP1-81445] - Staining of human nasopharynx shows strong positivity in cilia in respiratory epithelial cells.](http://images.novusbio.com/fullsize/CEP164-Antibody-Immunohistochemistry-Paraffin-NBP1-81445-img0010.jpg "Immunohistochemistry-Paraffin: CEP164 Antibody [NBP1-81445] - Staining of human nasopharynx shows strong positivity in cilia in respiratory epithelial cells.")
![Immunohistochemistry-Paraffin: CEP164 Antibody [NBP1-81445] - Staining of human endometrium shows strong positivity in cilia in glandular cells.](http://images.novusbio.com/fullsize/CEP164-Antibody-Immunohistochemistry-Paraffin-NBP1-81445-img0011.jpg "Immunohistochemistry-Paraffin: CEP164 Antibody [NBP1-81445] - Staining of human endometrium shows strong positivity in cilia in glandular cells.")
![Immunocytochemistry/ Immunofluorescence: CEP164 Antibody [NBP1-81445] - Fetuin-A inhibits ciliogenesis. (A–D) Primary cilia were examined in the absence (CTL) or presence of fetuin-A (FA) by immunostaining with antibodies against acetylated tubulin (Ace-tub), Cep164, IFT88, or Arl13b. (E) Quantification results of the frequency of ciliated HTR8 cells. ** p < 0.01, results are the mean ± SD from three independent experiments, more than 100 cells were counted in each individual group. DNA was stained with DAPI. Scale bar 10 µM. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31640125), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-81445_rabbit-polyclonal-cep164-antibody-31020241539453.jpg "Immunocytochemistry/ Immunofluorescence: CEP164 Antibody [NBP1-81445] - Fetuin-A inhibits ciliogenesis. (A–D) Primary cilia were examined in the absence (CTL) or presence of fetuin-A (FA) by immunostaining with antibodies against acetylated tubulin (Ace-tub), Cep164, IFT88, or Arl13b. (E) Quantification results of the frequency of ciliated HTR8 cells. ** p < 0.01, results are the mean ± SD from three independent experiments, more than 100 cells were counted in each individual group. DNA was stained with DAPI. Scale bar 10 µM. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31640125), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: CEP164 Antibody [NBP1-81445] - Super-resolution (3D-SIM) microscopic analysis of centriolar distal-end proteins. (a) RPE1 cells were synchronized at G2 phase & immunostained with the indicated antibodies. Lower panels show fluorescence profile plots. Representative images of more than ten cells are presented in (a). ND: nascent daughter centriole, M: mother centriole. (b) The diameters of C2CD3, Talpid3, CEP120, & CEP164 protein spots (n = 30/each). Cumulative data from three independent experiments are shown. ***P < 0.001. (c,d) 3D-SIM analysis of the spatial localizations of C2CD3 (c), Talpid3 (d) & CEP120 (c,d) at the distal ends of centrioles. RPE1 cells were synchronized at G2 phase & immunostained with the indicated antibodies. Scale bar, 100 nm in (a,c,d). (e) Schematic illustration of the spatial localizations of C2CD3, Talpid3, CEP120, & CP110 at the distal ends of centrioles. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30988386), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-81445_rabbit-polyclonal-cep164-antibody-310202416113546.jpg "Immunocytochemistry/ Immunofluorescence: CEP164 Antibody [NBP1-81445] - Super-resolution (3D-SIM) microscopic analysis of centriolar distal-end proteins. (a) RPE1 cells were synchronized at G2 phase & immunostained with the indicated antibodies. Lower panels show fluorescence profile plots. Representative images of more than ten cells are presented in (a). ND: nascent daughter centriole, M: mother centriole. (b) The diameters of C2CD3, Talpid3, CEP120, & CEP164 protein spots (n = 30/each). Cumulative data from three independent experiments are shown. ***P < 0.001. (c,d) 3D-SIM analysis of the spatial localizations of C2CD3 (c), Talpid3 (d) & CEP120 (c,d) at the distal ends of centrioles. RPE1 cells were synchronized at G2 phase & immunostained with the indicated antibodies. Scale bar, 100 nm in (a,c,d). (e) Schematic illustration of the spatial localizations of C2CD3, Talpid3, CEP120, & CP110 at the distal ends of centrioles. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30988386), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: CEP164 Antibody [NBP1-81445] - Depletion of RTTN produces shorter centrioles. a, b U2OS cells were treated with siControl or siRTTN as shown in a, & analyzed by confocal fluorescence microscopy using the indicated antibodies. cHistogram illustrating the distance between the CEP162-positive dots associated with a given pair of orthogonally oriented centrioles. Error bars represent the mean ± s.d.; ***P < 0.001 (two-tailed t-test). d, f PLK4-myc doxycycline (Dox) inducible cells were treated with siControl or siRTTN as shown in a, & then analyzed by confocal fluorescence microscopy using the indicated antibodies d, or by electron microscopy f. e, gHistogram illustrating the length of procentrioles in PLK4-myc-inducible cells, as analyzed by confocal microscopy e or electron microscopy g. Error bars represent the mean ± s.d.; ***P < 0.001 (two-tailed t-test). The procentriole length in b/c was measured as the distance between two CEP162 dots as described by Azimzadeh et al.17 The procentriole length in d/e was measured as the distance between the fluorescent peak intensity of SAS-6 (red) & CEP162 (green) in siControl & siRTTN-treated cells. Scale bar, 5 μm in b & d; Scale bar, 200 nm in f Image collected & cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-017-00305-0), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-81445_rabbit-polyclonal-cep164-antibody-310202416121961.jpg "Immunocytochemistry/ Immunofluorescence: CEP164 Antibody [NBP1-81445] - Depletion of RTTN produces shorter centrioles. a, b U2OS cells were treated with siControl or siRTTN as shown in a, & analyzed by confocal fluorescence microscopy using the indicated antibodies. cHistogram illustrating the distance between the CEP162-positive dots associated with a given pair of orthogonally oriented centrioles. Error bars represent the mean ± s.d.; ***P < 0.001 (two-tailed t-test). d, f PLK4-myc doxycycline (Dox) inducible cells were treated with siControl or siRTTN as shown in a, & then analyzed by confocal fluorescence microscopy using the indicated antibodies d, or by electron microscopy f. e, gHistogram illustrating the length of procentrioles in PLK4-myc-inducible cells, as analyzed by confocal microscopy e or electron microscopy g. Error bars represent the mean ± s.d.; ***P < 0.001 (two-tailed t-test). The procentriole length in b/c was measured as the distance between two CEP162 dots as described by Azimzadeh et al.17 The procentriole length in d/e was measured as the distance between the fluorescent peak intensity of SAS-6 (red) & CEP162 (green) in siControl & siRTTN-treated cells. Scale bar, 5 μm in b & d; Scale bar, 200 nm in f Image collected & cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-017-00305-0), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: CEP164 Antibody [NBP1-81445] - CPAP-E1235V mutation impaired the recruitment of centriole elongation proteins onto the centrioles. Cells were synchronized in the early S phase by treatment with aphidicolin (2 μg/ml) for 24 h. They were then fixed immediately with methanol (S phase centrioles) or released into fresh culture medium without aphidicolin for another 16 h (G2 phase centrioles). CPAP-WT or mutant cells in the S phase or G2 phase were immunostained with antibodies against the following centriolar proteins. (A) STIL, n = 42 for CPAP-WT; n = 25 for CPAP-E1235V#1; n = 34 for CPAP-E1235V#2. (B) CEP120, n = 50 for CPAP-WT; n = 42 for CPAP-E1235V#1; n = 48 for CPAP-E1235V#2. (C) CENTROBIN, n = 40 for all groups. (D) CEP295, n = 40 for all groups. (E) POC5, n = 42 for CPAP-WT; n = 40 for CPAP-E1235V#1; n = 40 for CPAP-E1235V#2. (F) POC1B, n = 40 for all groups. (G) CEP164, n = 88 for CPAP-WT; n = 74 for CPAP-E1235V#1; n = 38 for CPAP-E1235V#2. All data are presented as mean ±SEM from a pool of n cells from three independent experiments. n.s: not significant; **p < 0.01; ***p < 0.001. Scale bar: 5 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35309908), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-81445_rabbit-polyclonal-cep164-antibody-31020241613623.jpg "Immunocytochemistry/ Immunofluorescence: CEP164 Antibody [NBP1-81445] - CPAP-E1235V mutation impaired the recruitment of centriole elongation proteins onto the centrioles. Cells were synchronized in the early S phase by treatment with aphidicolin (2 μg/ml) for 24 h. They were then fixed immediately with methanol (S phase centrioles) or released into fresh culture medium without aphidicolin for another 16 h (G2 phase centrioles). CPAP-WT or mutant cells in the S phase or G2 phase were immunostained with antibodies against the following centriolar proteins. (A) STIL, n = 42 for CPAP-WT; n = 25 for CPAP-E1235V#1; n = 34 for CPAP-E1235V#2. (B) CEP120, n = 50 for CPAP-WT; n = 42 for CPAP-E1235V#1; n = 48 for CPAP-E1235V#2. (C) CENTROBIN, n = 40 for all groups. (D) CEP295, n = 40 for all groups. (E) POC5, n = 42 for CPAP-WT; n = 40 for CPAP-E1235V#1; n = 40 for CPAP-E1235V#2. (F) POC1B, n = 40 for all groups. (G) CEP164, n = 88 for CPAP-WT; n = 74 for CPAP-E1235V#1; n = 38 for CPAP-E1235V#2. All data are presented as mean ±SEM from a pool of n cells from three independent experiments. n.s: not significant; **p < 0.01; ***p < 0.001. Scale bar: 5 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35309908), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: CEP164 Antibody [NBP1-81445] - Depletion of RTTN produces shorter centrioles. a, b U2OS cells were treated with siControl or siRTTN as shown in a, & analyzed by confocal fluorescence microscopy using the indicated antibodies. cHistogram illustrating the distance between the CEP162-positive dots associated with a given pair of orthogonally oriented centrioles. Error bars represent the mean ± s.d.; ***P < 0.001 (two-tailed t-test). d, f PLK4-myc doxycycline (Dox) inducible cells were treated with siControl or siRTTN as shown in a, & then analyzed by confocal fluorescence microscopy using the indicated antibodies d, or by electron microscopy f. e, gHistogram illustrating the length of procentrioles in PLK4-myc-inducible cells, as analyzed by confocal microscopy e or electron microscopy g. Error bars represent the mean ± s.d.; ***P < 0.001 (two-tailed t-test). The procentriole length in b/c was measured as the distance between two CEP162 dots as described by Azimzadeh et al.17 The procentriole length in d/e was measured as the distance between the fluorescent peak intensity of SAS-6 (red) & CEP162 (green) in siControl & siRTTN-treated cells. Scale bar, 5 μm in b & d; Scale bar, 200 nm in f Image collected & cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-017-00305-0), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-81445_rabbit-polyclonal-cep164-antibody-310202416114711.jpg "Immunocytochemistry/ Immunofluorescence: CEP164 Antibody [NBP1-81445] - Depletion of RTTN produces shorter centrioles. a, b U2OS cells were treated with siControl or siRTTN as shown in a, & analyzed by confocal fluorescence microscopy using the indicated antibodies. cHistogram illustrating the distance between the CEP162-positive dots associated with a given pair of orthogonally oriented centrioles. Error bars represent the mean ± s.d.; ***P < 0.001 (two-tailed t-test). d, f PLK4-myc doxycycline (Dox) inducible cells were treated with siControl or siRTTN as shown in a, & then analyzed by confocal fluorescence microscopy using the indicated antibodies d, or by electron microscopy f. e, gHistogram illustrating the length of procentrioles in PLK4-myc-inducible cells, as analyzed by confocal microscopy e or electron microscopy g. Error bars represent the mean ± s.d.; ***P < 0.001 (two-tailed t-test). The procentriole length in b/c was measured as the distance between two CEP162 dots as described by Azimzadeh et al.17 The procentriole length in d/e was measured as the distance between the fluorescent peak intensity of SAS-6 (red) & CEP162 (green) in siControl & siRTTN-treated cells. Scale bar, 5 μm in b & d; Scale bar, 200 nm in f Image collected & cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-017-00305-0), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot Chk2 [p Thr68] Antibody [Unconjugated]](https://images.novusbio.com/images2/Chk2_AF1626_Western_Blot_5130.jpg)
![Immunocytochemistry Chk2 [p Thr68] Antibody [Unconjugated]](https://images.novusbio.com/images2/Chk2_AF1626_Immunocytochemistry__Immunofluorescence_18847.jpg)
![Western Blot Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/Histone_H2AX_AF2288_Western_Blot_5182.jpg)
![Simple Western Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/16395.jpg)
![Immunocytochemistry Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/Histone_H2AX_AF2288_Immunocytochemistry__Immunofluorescence_16920.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")