Home » CD177 » CD177 Proteins » CD177 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CD177 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CD177 Recombinant Protein Antigen (NBP2-58979PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CD177 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD177.

Source: E. coli

Amino Acid Sequence: DPGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPVCNL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD177
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58979.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD177 Recombinant Protein Antigen

  • CD177 antigenNB1 GP
  • CD177 molecule
  • CD177
  • HNA-2a
  • HNA2Acell surface receptor
  • Human neutrophil alloantigen 2a
  • NB1 GP
  • NB1PRV-1
  • polycythemia rubra vera 1
  • Polycythemia rubra vera protein 1
  • PRV1
  • PRV1NB1 glycoprotein

Background

NB1, a glycosyl-phosphatidylinositol (GPI)-linked N-glycosylated cell surface glycoprotein, was first described in a case of neonatal alloimmune neutropenia (Lalezari et al., 1971 [PubMed 5552408]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Jak2 Antibody
(53B7) - BSA Free
NBP2-59451
Flow Cytometry Jak2 Antibody (53B7) - BSA Free
Immunocytochemistry/ Immunofluorescence Jak2 Antibody (53B7) - BSA Free
Western Blot Jak2 Antibody (53B7) - BSA Free
(3 Reviews)
(3 Publications)
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, WB
Proteinase
3/Myeloblastin/PRTN3 ...
NBP1-25966
Western Blot Proteinase 3/Myeloblastin/PRTN3 Antibody
Immunocytochemistry/ Immunofluorescence Proteinase 3/Myeloblastin/PRTN3 Antibody
Immunocytochemistry/ Immunofluorescence Proteinase 3/Myeloblastin/PRTN3 Antibody
(2 Publications)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Thrombopoietin
R/Tpo R Antibody [Unc ...
AF1016
Simple Western Thrombopoietin R/Tpo R Antibody [Unconjugated]
Neutralization Thrombopoietin R/Tpo R Antibody [Unconjugated]
(4 Publications)
Species: Hu
Applications: Neut, Simple Western, WB
G-CSF Antibody
(67604) [Unconjugated
MAB414
Neutralization G-CSF Antibody (67604) [Unconjugated]
(60 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
Erythropoietin/EPO
[HRP]
MEP00B
N/A Erythropoietin/EPO [HRP]
N/A Erythropoietin/EPO [HRP]
(105 Publications)
Species: Mu
Applications: ELISA
CD11b Antibody -
BSA Free
NB110-89474
Immunocytochemistry/ Immunofluorescence CD11b Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CD11b Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CD11b Antibody - BSA Free
(12 Reviews)
(114 Publications)
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB

Thrombopoietin/THPO [U
288-TPN/CF
Bioactivity Thrombopoietin/THPO [Unconjugated]
(12 Publications)
Species: Hu
Applications: BA
Fc gamma RIII
(CD16) Antibody [Unco ...
AF1597
Western Blot Fc gamma RIII (CD16) Antibody [Unconjugated]
(9 Publications)
Species: Hu
Applications: Block, WB
Integrin beta
2/CD18 Antibody [Unco ...
AF1730
Immunocytochemistry Integrin beta 2/CD18 Antibody [Unconjugated]
Immunocytochemistry Integrin beta 2/CD18 Antibody [Unconjugated]
(16 Publications)
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Lymphotoxin beta
R/TNFRSF3 Antibody
AF629
Lymphotoxin beta R/TNFRSF3 Antibody
(10 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, InhibCellGro, WB
CD31/PECAM-1
Antibody [Unconjugate
AF3628
Immunohistochemistry CD31/PECAM-1 Antibody [Unconjugated]
Flow Cytometry CD31/PECAM-1 Antibody [Unconjugated]
Immunohistochemistry CD31/PECAM-1 Antibody [Unconjugated]
(6 Reviews)
(505 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Fc gamma
RIIIA/CD16a [Unconjug
4325-FC
SDS-PAGE Fc gamma RIIIA/CD16a [Unconjugated]
Binding Activity Fc gamma RIIIA/CD16a [Unconjugated]
SEC-MALS Fc gamma RIIIA/CD16a [Unconjugated]
(21 Publications)
Species: Hu
Applications: Bind
Integrin alpha
L/CD11a Antibody (345 ...
MAB3595
Western Blot Integrin alpha L/CD11a Antibody (345913) [Unconjugated]
Simple Western Integrin alpha L/CD11a Antibody (345913) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
GNPDA1 Antibody
NBP2-24653
Western Blot GNPDA1 Antibody
Immunohistochemistry-Paraffin GNPDA1 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Glucose 6
phosphate isomerase A ...
NBP2-02541
Western Blot Glucose 6 phosphate isomerase Antibody (OTI2D2)
Immunohistochemistry-Paraffin Glucose 6 phosphate isomerase Antibody (OTI2D2)
Immunohistochemistry-Paraffin Glucose 6 phosphate isomerase Antibody (OTI2D2)
(1 Publication)
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
G-CSF Antibody
(67604) [Unconjugated
MAB414
Neutralization G-CSF Antibody (67604) [Unconjugated]
(60 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
uPAR [HRP]
DUP00
N/A uPAR [HRP]
N/A uPAR [HRP]
(44 Publications)
Species: Hu
Applications: ELISA
EPX Antibody
(rEPO104)
NBP3-07388
Immunohistochemistry-Paraffin EPX Antibody (rEPO104)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P

Publications for CD177 Recombinant Protein Antigen (NBP2-58979PEP) (0)

There are no publications for CD177 Recombinant Protein Antigen (NBP2-58979PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD177 Recombinant Protein Antigen (NBP2-58979PEP) (0)

There are no reviews for CD177 Recombinant Protein Antigen (NBP2-58979PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD177 Recombinant Protein Antigen (NBP2-58979PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD177 Products

Blogs on CD177

There are no specific blogs for CD177, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD177 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CD177