Home » Carbonic Anhydrase III/CA3 » Carbonic Anhydrase III/CA3 Proteins » Carbonic Anhydrase III/CA3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Carbonic Anhydrase III/CA3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Carbonic Anhydrase III/CA3 Protein (NBP1-88227PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Carbonic Anhydrase III/CA3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CA3.

Source: E. coli

Amino Acid Sequence: YWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CA3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88227.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Carbonic Anhydrase III/CA3 Recombinant Protein Antigen

  • CA3
  • CAIII
  • CA-III
  • Car3
  • Carbonate dehydratase III
  • carbonic anhydrase 3
  • Carbonic Anhydrase III
  • carbonic anhydrase III, muscle specific
  • EC 4.2.1.1

Background

Carbonic anhydrase III (CAIII) is a member of a multigene family (at least six separate genes are known) that encode carbonic anhydrase isozymes. These carbonic anhydrases are a class of metalloenzymes that catalyze the reversible hydration of carbon dioxide and are differentially expressed in a number of cell types. The expression of the CA3 gene is strictly tissue specific and present at high levels in skeletal muscle and much lower levels in cardiac and smooth muscle. A proportion of carriers of Duchenne muscle dystrophy have a higher CA3 level than normal. The gene spans 10.3 kb and contains seven exons and six introns.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Carbonic Anhydrase
I/CA1 Antibody
NBP1-88191
Western Blot Carbonic Anhydrase I/CA1 Antibody
Immunohistochemistry-Paraffin Carbonic Anhydrase I/CA1 Antibody
Immunohistochemistry-Paraffin Carbonic Anhydrase I/CA1 Antibody
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Carbonic Anhydrase
II/CA2 Antibody
NB600-919
Western Blot Carbonic Anhydrase II/CA2 Antibody
Western Blot Carbonic Anhydrase II/CA2 Antibody
Immunohistochemistry-Paraffin Carbonic Anhydrase II/CA2 Antibody
(3 Reviews)
(11 Publications)
Species: Hu, Mu
Applications: ELISA, IHC, IHC-Fr, IHC-P, WB
Carbonic Anhydrase
IV/CA4 Antibody (3104 ...
MAB2186
Western Blot Carbonic Anhydrase IV/CA4 Antibody (310413) [Unconjugated]
(5 Publications)
Species: Hu
Applications: IHC, IP, WB
BDNF [HRP]
DBD00
N/A BDNF [HRP]
N/A BDNF [HRP]
N/A BDNF [HRP]
(104 Publications)
Species: Hu
Applications: ELISA
GFAP Antibody
NB300-141
Immunohistochemistry GFAP Antibody
Western Blot GFAP Antibody
Western Blot GFAP Antibody
(12 Reviews)
(108 Publications)
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
(1 Review)
(20 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Neuropeptide Y
Antibody
NBP1-46535
Immunohistochemistry Neuropeptide Y Antibody
Immunocytochemistry/ Immunofluorescence Neuropeptide Y Antibody
(20 Publications)
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB

Acetylcholinesterase/A
NBP1-31329
Western Blot Acetylcholinesterase/ACHE Antibody
Immunocytochemistry/ Immunofluorescence Acetylcholinesterase/ACHE Antibody
Western Blot Acetylcholinesterase/ACHE Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
GR/NR3C1 Antibody
(BuGR2) - BSA Free
NB300-731
Flow Cytometry GR/NR3C1 Antibody (BuGR2) - BSA Free
Flow Cytometry GR/NR3C1 Antibody (BuGR2) - BSA Free
Immunocytochemistry/ Immunofluorescence GR/NR3C1 Antibody (BuGR2) - BSA Free
(3 Reviews)
(12 Publications)
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Glutamine
Synthetase Antibody
NB110-41404
Immunocytochemistry/ Immunofluorescence Glutamine Synthetase Antibody
Western Blot Glutamine Synthetase Antibody
Immunohistochemistry Glutamine Synthetase Antibody
(1 Review)
(11 Publications)
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
(7 Reviews)
(388 Publications)
Species: Hu, Mu
Applications: ICC, IHC
GAD1/GAD67
Antibody [Unconjugate
AF2086
Immunohistochemistry GAD1/GAD67 Antibody [Unconjugated]
Western Blot GAD1/GAD67 Antibody [Unconjugated]
Simple Western GAD1/GAD67 Antibody [Unconjugated]
(13 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Calbindin D-28K
Antibody
NBP2-50028
Western Blot Calbindin D-28K Antibody
Immunocytochemistry/ Immunofluorescence Calbindin D-28K Antibody
Western Blot Calbindin D-28K Antibody
(1 Review)
(13 Publications)
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
Synaptophysin
Antibody - BSA Free
NBP2-25170
Western Blot Synaptophysin Antibody - BSA Free
Immunohistochemistry Synaptophysin Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Synaptophysin Antibody - BSA Free
(11 Publications)
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Somatostatin
Antibody (906552) [Un ...
MAB2358
Immunohistochemistry Somatostatin Antibody (906552) [Unconjugated]
Immunocytochemistry Somatostatin Antibody (906552) [Unconjugated]
Immunocytochemistry Somatostatin Antibody (906552) [Unconjugated]
(3 Publications)
Species: Hu, Mu
Applications: ICC, IHC
Parvalbumin
Antibody - BSA Free
NB120-11427
Immunohistochemistry-Paraffin Parvalbumin Antibody - BSA Free
Immunohistochemistry Parvalbumin Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Parvalbumin Antibody - BSA Free
(32 Publications)
Species: Fe, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
GAP-43 Antibody
NB300-143
Immunocytochemistry/ Immunofluorescence GAP-43 Antibody
Western Blot GAP-43 Antibody
Immunohistochemistry-Paraffin GAP-43 Antibody
(1 Review)
(101 Publications)
Species: Bv, Ca, Ch, Dr, Eq, Hu, Mu, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB

Publications for Carbonic Anhydrase III/CA3 Protein (NBP1-88227PEP) (0)

There are no publications for Carbonic Anhydrase III/CA3 Protein (NBP1-88227PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carbonic Anhydrase III/CA3 Protein (NBP1-88227PEP) (0)

There are no reviews for Carbonic Anhydrase III/CA3 Protein (NBP1-88227PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Carbonic Anhydrase III/CA3 Protein (NBP1-88227PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Carbonic Anhydrase III/CA3 Products

Research Areas for Carbonic Anhydrase III/CA3 Protein (NBP1-88227PEP)

Find related products by research area.

Blogs on Carbonic Anhydrase III/CA3

There are no specific blogs for Carbonic Anhydrase III/CA3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Caspase-3 Antibody [Unconjugated] - Active
AF835
Immunohistochemistry: GFAP Antibody [NB300-141] - Analysis of a rat cerebellum section stained with rabbit polyclonal antibody to GFAP, NB300-141, dilution 1:5000 in green and mouse monoclonal antibody to MeCP2, dilution 1:500, in red. The blue is DAPI staining of nuclear DNA. Following transcardial perfusion of rat with 4% paraformaldehyde, brain was post fixed for 1 hour, cut to 45 uM, and free-floating sections were stained with above antibodies. The GFAP antibody stains the network of astrocytic cells and the processes of Bergmann glia in the molecular layer. The MeCP2 antibody specifically labels nuclei of certain neurons.
GFAP Antibody
NB300-141

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Carbonic Anhydrase III/CA3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CA3