Home » Bone marrow stromal cell antigen 1/CD157 » Bone marrow stromal cell antigen 1/CD157 Proteins » Bone marrow stromal cell antigen 1/CD157 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Bone marrow stromal cell antigen 1/CD157 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Bone marrow stromal cell antigen 1/CD157 Protein (NBP2-14363PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Bone marrow stromal cell antigen 1/CD157 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BST1.

Source: E. coli

Amino Acid Sequence: EGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BST1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14363.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Bone marrow stromal cell antigen 1/CD157 Recombinant Protein Antigen

  • ADP-ribosyl cyclase 2
  • Bone marrow stromal antigen 1
  • bone marrow stromal cell antigen 1
  • BP-3
  • BST1
  • BST-1
  • cADPr hydrolase 2
  • CD157 antigen
  • CD157
  • Cyclic ADP-ribose hydrolase 2
  • EC 3.2.2.5
  • NAD(+) nucleosidase

Background

Bone marrow stromal cell antigen-1 is a stromal cell line-derived glycosylphosphatidylinositol-anchored molecule that facilitates pre-B-cell growth. The deduced amino acid sequence exhibits 33% similarity with CD38. BST1 expression is enhanced in bone marrow stromal cell lines derived from patients with rheumatoid arthritis. The polyclonal B-cell abnormalities in rheumatoid arthritis may be, at least in part, attributed to BST1 overexpression in the stromal cell population. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
CD38 Antibody
(1G7F4) - Azide Free
NBP2-25265
Immunohistochemistry-Paraffin CD38 Antibody (1G7F4) - Azide Free
Western Blot CD38 Antibody (1G7F4) - Azide Free
Simple Western CD38 Antibody (1G7F4) - Azide Free
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
alpha-Synuclein
Antibody
NBP2-15365
Immunohistochemistry-Frozen alpha-Synuclein Antibody
Immunohistochemistry-Frozen alpha-Synuclein Antibody
Immunocytochemistry/ Immunofluorescence alpha-Synuclein Antibody
(1 Review)
(12 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA, WB
LRRK2 Antibody -
BSA Free
NB300-268
Flow Cytometry LRRK2 Antibody - BSA Free
Immunohistochemistry-Paraffin LRRK2 Antibody - BSA Free
Flow Cytometry LRRK2 Antibody - BSA Free
(1 Review)
(46 Publications)
Species: Bv, Ce, Hu, I, Mu, Pl
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
GNPDA1 Antibody
NBP2-24653
Western Blot GNPDA1 Antibody
Immunohistochemistry-Paraffin GNPDA1 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Glucose 6
phosphate isomerase A ...
NBP2-02541
Western Blot Glucose 6 phosphate isomerase Antibody (OTI2D2)
Immunohistochemistry-Paraffin Glucose 6 phosphate isomerase Antibody (OTI2D2)
Immunohistochemistry-Paraffin Glucose 6 phosphate isomerase Antibody (OTI2D2)
(1 Publication)
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Exosome component
10 Antibody
NBP1-32870
Western Blot Exosome component 10 Antibody
Immunohistochemistry-Paraffin Exosome component 10 Antibody
Western Blot Exosome component 10 Antibody
(2 Reviews)
(3 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, KD, WB
CD117/c-kit
Antibody [Unconjugate
AF1356
Simple Western CD117/c-kit Antibody [Unconjugated]
Western Blot CD117/c-kit Antibody [Unconjugated]
Immunohistochemistry CD117/c-kit Antibody [Unconjugated]
(4 Reviews)
(116 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
GAK Antibody
(706306)
MAB6918
Western Blot GAK Antibody (706306)
(2 Publications)
Species: Hu
Applications: WB
Tau Antibody (2E9)
NBP2-25162
Immunocytochemistry/ Immunofluorescence Tau Antibody (2E9)
Western Blot Tau Antibody (2E9)
Immunocytochemistry/ Immunofluorescence Tau Antibody (2E9)
(5 Publications)
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
ICAM-1/CD54
Antibody [Unconjugate
AF796
Immunohistochemistry ICAM-1/CD54 Antibody [Unconjugated]
Western Blot ICAM-1/CD54 Antibody [Unconjugated]
Western Blot ICAM-1/CD54 Antibody [Unconjugated]
(6 Reviews)
(88 Publications)
Species: Mu
Applications: AdBlk, IHC, WB
Integrin beta
1/CD29 Antibody (P5D2 ...
MAB17781
Flow Cytometry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]
Immunocytochemistry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]
Flow Cytometry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]
(35 Publications)
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO

TRANCE/TNFSF11/RANK L
462-TEC
SDS-PAGE TRANCE/TNFSF11/RANK L [Unconjugated]
Bioactivity TRANCE/TNFSF11/RANK L [Unconjugated]
(91 Publications)
Species: Mu
Applications: BA
Oct-3/4 Antibody
[Unconjugated]
AF1759
Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]
Immunocytochemistry Oct-3/4 Antibody [Unconjugated]
Simple Western Oct-3/4 Antibody [Unconjugated]
(77 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(664 Publications)
Species: Mu
Applications: ELISA
MCAM/CD146
Antibody [Unconjugate
AF932
Immunohistochemistry MCAM/CD146 Antibody [Unconjugated]
Western Blot MCAM/CD146 Antibody [Unconjugated]
Immunohistochemistry MCAM/CD146 Antibody [Unconjugated]
(8 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Bone marrow
stromal cell antigen ...
NBP2-14363PEP
Bone marrow stromal cell antigen 1/CD157 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Bone marrow stromal cell antigen 1/CD157 Protein (NBP2-14363PEP) (0)

There are no publications for Bone marrow stromal cell antigen 1/CD157 Protein (NBP2-14363PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Bone marrow stromal cell antigen 1/CD157 Protein (NBP2-14363PEP) (0)

There are no reviews for Bone marrow stromal cell antigen 1/CD157 Protein (NBP2-14363PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Bone marrow stromal cell antigen 1/CD157 Protein (NBP2-14363PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Bone marrow stromal cell antigen 1/CD157 Products

Research Areas for Bone marrow stromal cell antigen 1/CD157 Protein (NBP2-14363PEP)

Find related products by research area.

Blogs on Bone marrow stromal cell antigen 1/CD157

There are no specific blogs for Bone marrow stromal cell antigen 1/CD157, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Simple Western lane view shows lysates of MO7e human megakaryocytic leukemic cell line, P815 mouse mastocytoma cell line and MC/9-2 mouse mast cell line, loaded at 0.2 mg/mL. A specific band was detected for CD117/c-kit at approximately 150-165 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse CD117/c-kit Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1356) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.        
CD117/c-kit Antibody [Unconjugated]
AF1356

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Bone marrow stromal cell antigen 1/CD157 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol BST1