Home » BLNK » BLNK Proteins » BLNK Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

BLNK Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for BLNK Protein (NBP2-14355PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

BLNK Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BLNK.

Source: E. coli

Amino Acid Sequence: EGGIMNKIKKLKVKAPPSVPRRDYASESPADEEEQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BLNK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14355.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BLNK Recombinant Protein Antigen

  • AGM4
  • B cell linker protein
  • BASH
  • B-cell adapter containing a SH2 domain protein
  • B-cell adapter containing a Src homology 2 domain protein
  • B-cell linker protein
  • B-cell linker
  • BLNK
  • BLNK-s
  • Cytoplasmic adapter protein
  • Ly57
  • MGC111051
  • SLP65
  • SLP-65BLNK-S
  • SLP65Ly57
  • Src homology 2 domain-containing leukocyte protein of 65 kDa

Background

B-cell linker protein (BLNK, also known as SLP65, BASH, and BCA) is a B cell adaptor that plays an important role in B cell development and in BCR-signal transduction. Since BLNK does not encode any intrinsic enzymatic activity, its function is to serve as a scaffold for assembling macromolecular complexes which includes enzymes (PLC gamma, Vav and Btk) and additional linker proteins (Grb2 and Nck) (1-3). In addition, BLNK binds Btk and is required for activation of the transcription factor NF-

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

BCR Antibody
AF5129
Western Blot BCR Antibody
(1 Publication)
Species: Hu
Applications: WB
BTK [p Tyr223]
Antibody - BSA Free
NBP1-78295
Immunohistochemistry BTK [p Tyr223] Antibody - BSA Free
Western Blot BTK [p Tyr223] Antibody - BSA Free
(6 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
SYK Antibody
NBP1-32945
Western Blot SYK Antibody
Western Blot SYK Antibody
Immunoprecipitation SYK Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
CD40/TNFRSF5
Antibody [Unconjugate
AF632
Agonist Activity CD40/TNFRSF5 Antibody [Unconjugated]
Western Blot CD40/TNFRSF5 Antibody [Unconjugated]
Simple Western CD40/TNFRSF5 Antibody [Unconjugated]
(7 Publications)
Species: Hu
Applications: AgAct, Simple Western, WB
BAFF/BLyS/TNFSF13B
[HRP]
DBLYS0B
N/A BAFF/BLyS/TNFSF13B [HRP]
N/A BAFF/BLyS/TNFSF13B [HRP]
(67 Publications)
Species: Hu
Applications: ELISA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(656 Publications)
Species: Mu
Applications: ELISA
CD40 Ligand/TNFSF5
[HRP]
DCDL40
N/A CD40 Ligand/TNFSF5 [HRP]
N/A CD40 Ligand/TNFSF5 [HRP]
(44 Publications)
Species: Hu
Applications: ELISA
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
SLP-76/LCP2 [p
Tyr145] Antibody (776 ...
MAB7474
Simple Western SLP-76/LCP2 [p Tyr145] Antibody (776503) [Unconjugated]
Western Blot SLP-76/LCP2 [p Tyr145] Antibody (776503) [Unconjugated]
Immunocytochemistry SLP-76/LCP2 [p Tyr145] Antibody (776503) [Unconjugated]
Species: Hu
Applications: ICC, Simple Western, WB
CD19 Antibody
(CB19) - BSA Free
NBP2-25196
Flow Cytometry CD19 Antibody (CB19) - BSA Free
Flow Cytometry CD19 Antibody (CB19) - BSA Free
Flow Cytometry CD19 Antibody (CB19) - BSA Free
(1 Review)
(12 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
CD23/Fc epsilon
RII Antibody [Unconju ...
AF123
Immunocytochemistry CD23/Fc epsilon RII Antibody [Unconjugated]
(1 Review)
(2 Publications)
Species: Hu
Applications: Block, ICC, WB
IL-10 [Biotin]
DY417
N/A IL-10 [Biotin]
(299 Publications)
Species: Mu
Applications: ELISA
BLNK Recombinant
Protein Antigen
NBP2-14355PEP
BLNK Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for BLNK Protein (NBP2-14355PEP) (0)

There are no publications for BLNK Protein (NBP2-14355PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BLNK Protein (NBP2-14355PEP) (0)

There are no reviews for BLNK Protein (NBP2-14355PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BLNK Protein (NBP2-14355PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BLNK Products

Research Areas for BLNK Protein (NBP2-14355PEP)

Find related products by research area.

Blogs on BLNK

There are no specific blogs for BLNK, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BLNK Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol BLNK