Home » Aurora B » Aurora B Proteins » Aurora B Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Aurora B Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Aurora B Recombinant Protein Antigen (NBP2-55144PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Aurora B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Aurora B.

Source: E. coli

Amino Acid Sequence: WPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTID

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AURKB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55144.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Aurora B Recombinant Protein Antigen

  • Aik2
  • AIK2EC 2.7.11.1
  • AIM1
  • AIM-1
  • AIM1Aik2
  • AIM-1STK-1
  • ARK2
  • ARK2ARK-2
  • AurB
  • AURKB
  • aurkb-sv2
  • Aurora- and IPL1-like midbody-associated protein 1
  • Aurora B
  • aurora kinase BSerine/threonine-protein kinase aurora-B
  • aurora kinase B-Sv1
  • aurora kinase B-Sv2
  • Aurora/IPL1-related kinase 2
  • aurora-1
  • aurora-B
  • Aurora-related kinase 2
  • EC 2.7.11
  • IPL1
  • serine/threonine kinase 12
  • serine/threonine-protein kinase 12
  • STK12
  • STK12aurkb-sv1
  • STK5

Background

Aurora-B is a member of a novel family of serine/threonine kinases that have been identified as key regulators of the mitotic cell division process. Aurora-B is known to be involved in the regulation of centrosome function, bipolar spindle assembly and chromosome segregation. Aurora kinases are localized at the centrosomes of interphase cells, at the poles of the bipolar spindle and in the midbody of the mitotic apparatus. Substrates identified for the Aurora-B kinases include a kinesin-like motor protein, spindle apparatus proteins, histone H3 protein, kinetochore protein and the tumor suppressor protein p53 (1). Overexpression of aurora B produced multinuclearity and induced aggressive metastasis, suggesting that overexpressed aurora B has multiple functions in cancer development. Identification of Aurora kinases as RasGAP Src homology 3 domain binding protein, also implicates these kinases as potential effectors in the Ras pathway relevant to oncogenesis (2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Aurora A Antibody
- BSA Free
NBP1-51843
Western Blot Aurora A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Aurora A Antibody - BSA Free
Simple Western Aurora A Antibody - BSA Free
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
INCENP Antibody
(3D2) - BSA Free
NBP2-37471
ELISA INCENP Antibody (3D2) - BSA Free
Western Blot INCENP Antibody (3D2) - BSA Free
Western Blot INCENP Antibody (3D2) - BSA Free
(1 Publication)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Aurora B Antibody
- BSA Free
NB100-294
Immunocytochemistry/ Immunofluorescence Aurora B Antibody - BSA Free
Western Blot Aurora B Antibody - BSA Free
(5 Reviews)
(12 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Flt-3/Flk-2/CD135
Antibody (66903) [Unc ...
MAB812
Flow Cytometry Flt-3/Flk-2/CD135 Antibody (66903) [Unconjugated]
Flow Cytometry Flt-3/Flk-2/CD135 Antibody (66903) [Unconjugated]
(4 Publications)
Species: Hu
Applications: CyTOF-ready, Flow
Histone H3
Antibody - BSA Free
NB500-171
Immunohistochemistry-Paraffin Histone H3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Histone H3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Histone H3 Antibody - BSA Free
(8 Reviews)
(33 Publications)
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Aurora C Antibody
(OTI2B7)
NBP1-47663
Western Blot Aurora C Antibody (OTI2B7)
Immunohistochemistry-Paraffin Aurora C Antibody (OTI2B7)
Immunohistochemistry-Paraffin Aurora C Antibody (OTI2B7)
Species: Hu
Applications: IHC, IHC-P, WB
Survivin Antibody
- BSA Free
NB500-201
Flow Cytometry Survivin Antibody - BSA Free
Dual RNAscope ISH-IHC Survivin Antibody - BSA Free
Knockdown Validated Survivin Antibody - BSA Free
(22 Reviews)
(373 Publications)
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
PLK1 Antibody
(OTI1D4)
NBP1-48291
Western Blot PLK1 Antibody (OTI1D4)
Immunohistochemistry-Paraffin PLK1 Antibody (OTI1D4)
Immunohistochemistry-Paraffin PLK1 Antibody (OTI1D4)
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Survivin Antibody
- BSA Free
NB500-201
Flow Cytometry Survivin Antibody - BSA Free
Dual RNAscope ISH-IHC Survivin Antibody - BSA Free
Knockdown Validated Survivin Antibody - BSA Free
(22 Reviews)
(373 Publications)
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Cyclin B1 Antibody
[Unconjugated]
AF6000
Immunohistochemistry Cyclin B1 Antibody [Unconjugated]
Western Blot Cyclin B1 Antibody [Unconjugated]
Simple Western Cyclin B1 Antibody [Unconjugated]
(12 Publications)
Species: Hu, Mu
Applications: IHC, Simple Western, WB
CDC2/CDK1 Antibody
NBP1-85729
Immunohistochemistry-Paraffin CDC2/CDK1 Antibody
Western Blot CDC2/CDK1 Antibody
Western Blot CDC2/CDK1 Antibody
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Borealin Antibody
NBP1-89951
Immunocytochemistry/ Immunofluorescence Borealin Antibody
Western Blot Borealin Antibody
Immunohistochemistry-Paraffin Borealin Antibody
(4 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Aurora A Antibody
- BSA Free
NBP1-51843
Western Blot Aurora A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Aurora A Antibody - BSA Free
Simple Western Aurora A Antibody - BSA Free
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
BubR1 Antibody
(8G1) - BSA Free
NB100-353
Flow Cytometry BubR1 Antibody (8G1) - BSA Free
Immunocytochemistry/ Immunofluorescence BubR1 Antibody (8G1) - BSA Free
Western Blot BubR1 Antibody (8G1) - BSA Free
(1 Review)
(8 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
Inorganic
Pyrophosphatase/PPA1
NBP1-31348
Immunocytochemistry/ Immunofluorescence Inorganic Pyrophosphatase/PPA1 Antibody
Western Blot Inorganic Pyrophosphatase/PPA1 Antibody
Western Blot Inorganic Pyrophosphatase/PPA1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
KIF2C Antibody
(1G2)
H00011004-M01
Immunocytochemistry/ Immunofluorescence KIF2C Antibody (1G2)
Immunohistochemistry-Paraffin KIF2C Antibody (1G2)
Immunoprecipitation KIF2C Antibody (1G2)
(4 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, S-ELISA, WB
MAD2L1 Antibody
NB100-563
Immunohistochemistry MAD2L1 Antibody
Immunoprecipitation MAD2L1 Antibody
(1 Review)
(14 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for Aurora B Recombinant Protein Antigen (NBP2-55144PEP) (0)

There are no publications for Aurora B Recombinant Protein Antigen (NBP2-55144PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aurora B Recombinant Protein Antigen (NBP2-55144PEP) (0)

There are no reviews for Aurora B Recombinant Protein Antigen (NBP2-55144PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Aurora B Recombinant Protein Antigen (NBP2-55144PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Aurora B Products

Research Areas for Aurora B Recombinant Protein Antigen (NBP2-55144PEP)

Find related products by research area.

Blogs on Aurora B

There are no specific blogs for Aurora B, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: Survivin Antibody [NB500-201] - An intracellular stain was performed on HeLa cells with [NB500-201] and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550.
Survivin Antibody - BSA Free
NB500-201
Immunocytochemistry/Immunofluorescence: Aurora B Antibody - BSA Free [NB100-294] - HeLa human cervix epitheloid carcinoma cells were fixed and permeabilized with 4% paraformaldehyde followed by cold methanol. Fixed cells were stained with 1:50 Anti-Aurora B antibody produced in rabbit. The antibody was developed using Anti-Rabbit IgG (whole molecule)-FITC antibody produced in goat.
Aurora B Antibody - BSA Free
NB100-294
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
p53 Antibody (PAb 240) - BSA Free
NB200-103

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Aurora B Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol AURKB