Home » ATP5S » ATP5S Proteins » ATP5S Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ATP5S Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ATP5S Protein (NBP2-14333PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ATP5S Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATP5S.

Source: E. coli

Amino Acid Sequence: MCCAVSEQRLTCADQMMLFGKISQQLCGVKKLPWSCDSRYFWGWLNAVFNKVDYDRIRDVGPDRAASEWLLRC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ATP5S
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14333.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ATP5S Recombinant Protein Antigen

  • ATP synthase coupling factor B-like 1
  • ATP synthase subunit s, mitochondrial
  • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit s (factor B)
  • ATP synthase, H+ transporting, mitochondrial Fo complex, subunit s (factor B)
  • ATP synthase-coupling factor B
  • ATPWATP synthase coupling factor B, mitochondrial
  • HSU79253
  • Mitochondrial ATP synthase regulatory component factor B

Background

The ATP5S gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis,utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATPsynthase is composed of two linke

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

FACA/FANCA Antibody
NB100-2564
Western Blot FACA/FANCA Antibody
(1 Publication)
Species: Hu
Applications: WB
Frataxin Antibody
(OTI1C12)
NBP2-01743
Flow Cytometry Frataxin Antibody (OTI1C12)
Western Blot Frataxin Antibody (OTI1C12)
Immunohistochemistry-Paraffin Frataxin Antibody (OTI1C12)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
BBS9 Antibody
NBP1-88927
Immunohistochemistry-Paraffin BBS9 Antibody
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
CD20 Antibody
(AISB12) - BSA Free
NBP1-43435
Western Blot CD20 Antibody (AISB12) - BSA Free
Flow Cytometry CD20 Antibody (AISB12) - BSA Free
(3 Publications)
Species: Hu, Mu
Applications: Flow, WB
SPANXB1 Antibody
H00728695-B01P
Immunocytochemistry/ Immunofluorescence SPANXB1 Antibody
Western Blot SPANXB1 Antibody
Species: Hu
Applications: ICC/IF, IP, WB
Complement Factor
B Antibody
NBP1-89985
Immunocytochemistry/ Immunofluorescence Complement Factor B Antibody
Immunohistochemistry-Paraffin Complement Factor B Antibody
Immunohistochemistry-Paraffin Complement Factor B Antibody
(7 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
CRAT Antibody
NBP1-86616
Western Blot CRAT Antibody
Western Blot CRAT Antibody
Immunohistochemistry-Paraffin CRAT Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
GLYAT Antibody
NBP2-58917
Western Blot GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Species: Hu
Applications: IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(809 Publications)
Species: Hu
Applications: BA
Complement C3
Antibody (11H9) - BSA ...
NB200-540
Flow Cytometry Complement C3 Antibody (11H9) - BSA Free
Immunocytochemistry/ Immunofluorescence Complement C3 Antibody (11H9) - BSA Free
Immunohistochemistry-Paraffin Complement C3 Antibody (11H9) - BSA Free
(2 Reviews)
(31 Publications)
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(643 Publications)
Species: Mu
Applications: ELISA
Complement Factor
H Antibody [Unconjuga ...
AF4779
Immunohistochemistry Complement Factor H Antibody [Unconjugated]
(1 Review)
(2 Publications)
Species: Hu
Applications: IHC, WB
Coagulation Factor
X Antibody
NBP1-33320
Western Blot Coagulation Factor X Antibody
Immunocytochemistry/ Immunofluorescence Coagulation Factor X Antibody
Immunohistochemistry-Paraffin Coagulation Factor X Antibody
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Thymosin beta 4
Antibody [Unconjugate
AF6796
Western Blot Thymosin beta 4 Antibody [Unconjugated]
Immunocytochemistry Thymosin beta 4 Antibody [Unconjugated]
Simple Western Thymosin beta 4 Antibody [Unconjugated]
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
TSTA3 Antibody
NBP1-83408
Western Blot TSTA3 Antibody
Immunocytochemistry/ Immunofluorescence TSTA3 Antibody
Immunohistochemistry-Paraffin TSTA3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
LIGHT/TNFSF14
[Unconjugated]
664-LI
SDS-PAGE LIGHT/TNFSF14 [Unconjugated]
Bioactivity LIGHT/TNFSF14 [Unconjugated]
(21 Publications)
Species: Hu
Applications: BA
ATP5S Recombinant
Protein Antigen
NBP2-14333PEP
ATP5S Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for ATP5S Protein (NBP2-14333PEP) (0)

There are no publications for ATP5S Protein (NBP2-14333PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP5S Protein (NBP2-14333PEP) (0)

There are no reviews for ATP5S Protein (NBP2-14333PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ATP5S Protein (NBP2-14333PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATP5S Products

Blogs on ATP5S

There are no specific blogs for ATP5S, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ATP5S Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ATP5S