Reactivity | MuSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Concentration | 0.5 mg/ml |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse ATF3. Peptide sequence: ESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFI The peptide sequence for this immunogen was taken from within the described region. |
Clonality | Polyclonal |
Host | Rabbit |
Gene | ATF3 |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS, 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Concentration | 0.5 mg/ml |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ATF3 Antibody (NBP2-87049)Find related products by research area.
|
Chemotherapy-induced metastasis: An unexpected foe? By Yoskaly Lazo-Fernandez, PhD IntroductionEvidence has accumulated recently indicating that common cancer therapies might stimulate metastasis in a significant number of cancer patients1. In fact, neoadjuvant che... Read full blog post. |
Multifaceted Roles of Matrix Metalloproteinase-2 (MMP2) in Normal and Disease State MMP2 is a 72 kDa enzymatic protein and it belongs to matrix metalloproteinases (MMPs), a heterogenous family of zinc/calcium-dependent TIMPs (tissue inhibitors of matrix metalloproteinases) regulated matrix-degrading endopeptidases which are class... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | ATF3 |