Novus Biologicals products are now on bio-techne.com

Ataxin-2 Recombinant Protein Antigen

Images

 
There are currently no images for Ataxin-2 Protein (NBP1-90064PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Ataxin-2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATXN2.

Source: E. coli

Amino Acid Sequence: RHPRNHRVSAGRGSISSGLEFVSHNPPSEAATPPVARTSPSGGTWSSVVSGVPRLSPKTHRPRSPRQNSIGNTPSGPVLASPQAGIIPTEAVAMPIPAASPTPASPASNRAVTPSSEAKDSRLQDQRQNSPAGNKENIKPNET

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ATXN2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90064.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Ataxin-2 Recombinant Protein Antigen

  • ataxin 2
  • ataxin 2)
  • ataxin-2
  • ATX2spinocerebellar ataxia 2 (olivopontocerebellar ataxia 2, autosomal dominant
  • SCA2FLJ46772
  • Spinocerebellar ataxia type 2 protein
  • TNRC13
  • trinucleotide repeat containing 13
  • Trinucleotide repeat-containing gene 13 protein

Background

The autosomal dominant cerebellar ataxias (ADCA) are a heterogeneous group of neurodegenerative disorders characterized by progressive degeneration of the cerebellum, brain stem and spinal cord. Clinically, ADCA has been divided into three groups: ADCA types I-III. ADCAI is genetically heterogeneous, with five genetic loci, designated spinocerebellar ataxia (SCA) 1, 2, 3, 4 and 6, being assigned to five different chromosomes. ADCAII, which always presents with retinal degeneration (SCA7), and ADCAIII often referred to as the `pure' cerebellar syndrome (SCA5), are most likely homogeneous disorders. Several SCA genes have been cloned and shown to contain CAG repeats in their coding regions. ADCA is caused by the expansion of the CAG repeats, producing an elongated polyglutamine tract in the corresponding protein. The expanded repeats are variable in size and unstable, usually increasing in size when transmitted to successive generations. The function of the ataxins is not known. This locus has been mapped to chromosome 12, and it has been determined that the diseased allele contains 36-52 CAG repeats, compared to 22-23 in the normal allele. A potential transcript variant, missing an internal coding exon, has been described; however, its full-length nature is not certain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-25371
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-51689
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP3-30941
Species: Hu, Rt
Applications: IHC, WB
NBP1-42657
Species: Hu
Applications: IP (-), WB
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-46667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-13106
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-14336
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00023435-M01
Species: Ba, Pp, Hu, I, Pm, Mu, Rt
Applications: ELISA, Func, ICC/IF, IHC, IHC-P, IP, KD, WB
AF1436
Species: Mu
Applications: WB
NBP2-13169
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP2-01743
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB120-6125
Species: Bv, Ca, Dr(-), Hu, Mu(-), Pm, Xp
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IP, MiAr, WB
NBP2-56984
Species: Hu
Applications: ICC/IF
H00005173-M01
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
NBP2-54439
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA, WB
H00006532-D01P
Species: Hu, Mu
Applications: WB
NBP1-90064PEP
Species: Hu
Applications: AC

Publications for Ataxin-2 Protein (NBP1-90064PEP) (0)

There are no publications for Ataxin-2 Protein (NBP1-90064PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ataxin-2 Protein (NBP1-90064PEP) (0)

There are no reviews for Ataxin-2 Protein (NBP1-90064PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Ataxin-2 Protein (NBP1-90064PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ataxin-2 Products

Research Areas for Ataxin-2 Protein (NBP1-90064PEP)

Find related products by research area.

Blogs on Ataxin-2

There are no specific blogs for Ataxin-2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Ataxin-2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ATXN2