![Western Blot: AP2M1 Antibody (10J8D1) [NBP3-15341] - Western blot analysis of extracts of various cell lines, using AP2M1 Rabbit mAb (NBP3-15341) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.](http://images.novusbio.com/fullsize/AP2M1-Antibody-10J8D1-Western-Blot-NBP3-15341-img0002.jpg "Western Blot: AP2M1 Antibody (10J8D1) [NBP3-15341] - Western blot analysis of extracts of various cell lines, using AP2M1 Rabbit mAb (NBP3-15341) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clone | 10J8D1 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human AP2M1 (Q96CW1). KLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLK |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | AP2M1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunocytochemistry FosB/G0S3 Antibody [Unconjugated]](https://images.novusbio.com/images2/FosB_AF2214_Immunocytochemistry__Immunofluorescence_21634.jpg)
![Immunohistochemistry FosB/G0S3 Antibody [Unconjugated]](https://images.novusbio.com/images2/FosB_AF2214_Immunohistochemistry_9938.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for AP2M1 Antibody (NBP3-15341)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | AP2M1 |
![Immunocytochemistry/Immunofluorescence: AP2M1 Antibody (10J8D1) [NBP3-15341] - Immunofluorescence analysis of U-251MG cells using AP2M1 Rabbit mAb (NBP3-15341) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/AP2M1-Antibody-10J8D1-Immunocytochemistry-Immunofluorescence-NBP3-15341-img0001.jpg "Immunocytochemistry/Immunofluorescence: AP2M1 Antibody (10J8D1) [NBP3-15341] - Immunofluorescence analysis of U-251MG cells using AP2M1 Rabbit mAb (NBP3-15341) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Western Blot: AP2M1 Antibody (10J8D1) [AP2M1] - Western blot analysis of various lysates using AP2M1 Rabbit mAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.](http://images.novusbio.com/fullsize/nbp3-15341_rabbit-ap2m1-mab-10j8d1-52202517162342.jpg "Western Blot: AP2M1 Antibody (10J8D1) [AP2M1] - Western blot analysis of various lysates using AP2M1 Rabbit mAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.")
![Immunocytochemistry/ Immunofluorescence: AP2M1 Antibody (10J8D1) [AP2M1] - Immunofluorescence analysis of U-251MG cells using AP2M1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-15341_rabbit-ap2m1-mab-10j8d1-52202517162319.jpg "Immunocytochemistry/ Immunofluorescence: AP2M1 Antibody (10J8D1) [AP2M1] - Immunofluorescence analysis of U-251MG cells using AP2M1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry FABP4/A-FABP Antibody [Unconjugated]](https://images.novusbio.com/images2/FABP4_AF1443_Immunocytochemistry_6471.jpg)
![Western Blot FABP4/A-FABP Antibody [Unconjugated]](https://images.novusbio.com/images2/FABP4_AF1443_Western_Blot_17166.jpg)
![Immunohistochemistry FABP4/A-FABP Antibody [Unconjugated]](https://images.novusbio.com/images2/FABP4_AF1443_Immunohistochemistry_7312.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")