![Western Blot: Annexin A4 Antibody [NBP1-90151] - Analysis in human cell lines A-549 and HeLa using anti-ANXA4 antibody. Corresponding ANXA4 RNA-seq data are presented for the same cell lines. Loading control: anti-COX4I1.](http://images.novusbio.com/fullsize/Annexin-A4-Antibody-Western-Blot-NBP1-90151-img0012.jpg "Western Blot: Annexin A4 Antibody [NBP1-90151] - Analysis in human cell lines A-549 and HeLa using anti-ANXA4 antibody. Corresponding ANXA4 RNA-seq data are presented for the same cell lines. Loading control: anti-COX4I1.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ANXA4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Theoretical MW | 36 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Annexin A4 Antibody (NBP1-90151)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: Annexin A4 Antibody [NBP1-90151] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.](http://images.novusbio.com/fullsize/Annexin-A4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90151-img0009.jpg "Immunocytochemistry/Immunofluorescence: Annexin A4 Antibody [NBP1-90151] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.")
![Immunohistochemistry-Paraffin: Annexin A4 Antibody [NBP1-90151] - Staining of human pancreas shows distinct positivity in ductal cells.](http://images.novusbio.com/fullsize/Annexin-A4-Antibody-Immunohistochemistry-Paraffin-NBP1-90151-img0002.jpg "Immunohistochemistry-Paraffin: Annexin A4 Antibody [NBP1-90151] - Staining of human pancreas shows distinct positivity in ductal cells.")
![Western Blot: Annexin A4 Antibody [NBP1-90151] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/Annexin-A4-Antibody-Western-Blot-NBP1-90151-img0008.jpg "Western Blot: Annexin A4 Antibody [NBP1-90151] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0001.jpg)
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0003.jpg)
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0004.jpg)
![Western Blot Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Western_Blot_5334.jpg)
![Immunohistochemistry Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Immunohistochemistry_10404.jpg)
![Simple Western Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Simple_Western_16649.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot Annexin A7 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A7_AF3926_Western_Blot_5364.jpg)
![Simple Western Annexin A7 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3926_human-mouse-rat-annexin-a7-affinity-purified-polyclonal-ab-simple-western-7112024125536..jpg)
![Simple Western 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/1433_zeta_MAB2669_Simple_Western_16526.jpg)
![Western Blot 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/14-3-3_zeta_MAB2669_Western_Blot_12700.jpg)
![Immunohistochemistry 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/14-3-3_zeta_MAB2669_Immunohistochemistry_12730.jpg)
![Western Blot Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Western_Blot_10680.jpg)
![Immunohistochemistry Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Immunohistochemistry_10732.jpg)
![ELISA Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_ELISA_22233.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")