![Western Blot: ALG6 Antibody (2G11) [H00029929-M09] - Analysis of ALG6 expression in Hela S3 NE (Cat # L013V3).](http://images.novusbio.com/fullsize/ALG6-Antibody-2G11-Western-Blot-H00029929-M09-img0004.jpg "Western Blot: ALG6 Antibody (2G11) [H00029929-M09] - Analysis of ALG6 expression in Hela S3 NE (Cat # L013V3).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 2G11 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | ALG6 (NP_037471, 25 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SYSGAGKPPMFGDYEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGLDYPPLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRT |
| Specificity | ALG6 (2G11) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ALG6 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against cell lysate for western blot. It has also been used for ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: ALG6 Antibody (2G11) [H00029929-M09] - Analysis of monoclonal antibody to ALG6 on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/fullsize/ALG6-Antibody-2G11-Immunocytochemistry-Immunofluorescence-H00029929-M09-img0003.jpg "Immunocytochemistry/Immunofluorescence: ALG6 Antibody (2G11) [H00029929-M09] - Analysis of monoclonal antibody to ALG6 on HeLa cell. Antibody concentration 10 ug/ml")
![N/A SLPI [HRP]](https://images.novusbio.com/images2/DATA_SLPI_DPI00_ELISA_792.jpg)
![N/A SLPI [HRP]](https://images.novusbio.com/images2/SLPI_DPI00_ELISA_160.jpg)
![Western Blot Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2b_MAB7616_Western_Blot_12490.jpg)
![Flow Cytometry Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2b_MAB7616_Flow_Cytometry_12540.jpg)
![Flow Cytometry Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]](https://images.novusbio.com/images2/mab7616_human-integrin-alpha-2b-cd41-mab-clone-2530a-flow-cytometry-2462022151722.jpg)
![Immunocytochemistry FABP6 Antibody [Unconjugated]](https://images.novusbio.com/images2/FABP6_AF3880_Immunocytochemistry__Immunofluorescence_20097.jpg)
