![Western Blot: AHR Antibody (3B12) [H00000196-M02] - Analysis of AHR expression in transfected 293T cell line by AHR monoclonal antibody (M02), clone 3B12.Lane 1: AHR transfected lysate(96.147 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/AHR-Antibody-3B12-Western-Blot-H00000196-M02-img0016.jpg "Western Blot: AHR Antibody (3B12) [H00000196-M02] - Analysis of AHR expression in transfected 293T cell line by AHR monoclonal antibody (M02), clone 3B12.Lane 1: AHR transfected lysate(96.147 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IP, ChIP, KD |
| Clone | 3B12 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | AHR (NP_001612, 721 a.a. ~ 820 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINN |
| Specificity | aryl hydrocarbon receptor |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | AHR |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against cell lysate, transfected lysate and recombinant protein for WB. It has been used for IF, RNAi Validation, and ELISA. ChIP usage reported in scientific literature (PMID: 23714156). |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for AHR Antibody (H00000196-M02)Find related products by research area.
|
|
AHR - A transcription factor regulating immunity and tumorigenesis The aryl hydrocarbon receptor (AHR) is a ligand activated transcription factor that controls the expression of a diverse set of genes. In the absence of ligand, AHR is retained in the cytoplasm. Upon ligand binding AHR translocates to the nucleus w... Read full blog post. |
|
Aryl Hydrocarbon Signaling: AIP, AhR, ARNT, BMAL1 and more... AH receptor-interacting protein (AIP) is a 37 kD immunophilin-like factor found in a variety of tissues with expression levels ranging from high (spleen, thymus, pituitary heart, placenta and skeletal muscle) to low (liver, kidney and lung). It mediat... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: AHR Antibody (3B12) [H00000196-M02] - Analysis of monoclonal antibody to AHR on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/AHR-Antibody-3B12-Immunocytochemistry-Immunofluorescence-H00000196-M02-img0012.jpg "Immunocytochemistry/Immunofluorescence: AHR Antibody (3B12) [H00000196-M02] - Analysis of monoclonal antibody to AHR on HeLa cell. Antibody concentration 10 ug/ml.")
![Western Blot: AHR Antibody (3B12) [H00000196-M02] - Analysis of AHR expression in COLO 320 HSR ( Cat # L020V1 ).](http://images.novusbio.com/fullsize/AHR-Antibody-3B12-Western-Blot-H00000196-M02-img0008.jpg "Western Blot: AHR Antibody (3B12) [H00000196-M02] - Analysis of AHR expression in COLO 320 HSR ( Cat # L020V1 ).")
![Western Blot: AHR Antibody (3B12) [H00000196-M02] - Analysis of AHR over-expressed 293 cell line, cotransfected with AHR Validated Chimera RNAi ( Cat # H00000196-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with AHR monoclonal antibody (M02), clone 3B12 (Cat # H00000196-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.](http://images.novusbio.com/fullsize/AHR-Antibody-3B12-Western-Blot-H00000196-M02-img0014.jpg "Western Blot: AHR Antibody (3B12) [H00000196-M02] - Analysis of AHR over-expressed 293 cell line, cotransfected with AHR Validated Chimera RNAi ( Cat # H00000196-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with AHR monoclonal antibody (M02), clone 3B12 (Cat # H00000196-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.")
![Immunoprecipitation: AHR Antibody (3B12) [H00000196-M02] - Analysis of AHR transfected lysate using anti-AHR monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with AHR MaxPab rabbit polyclonal antibody.](http://images.novusbio.com/fullsize/AHR-Antibody-3B12-Immunoprecipitation-H00000196-M02-img0013.jpg "Immunoprecipitation: AHR Antibody (3B12) [H00000196-M02] - Analysis of AHR transfected lysate using anti-AHR monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with AHR MaxPab rabbit polyclonal antibody.")
![ELISA: AHR Antibody (3B12) [H00000196-M02] - Detection limit for recombinant GST tagged AHR is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/AHR-Antibody-3B12-ELISA-H00000196-M02-img0015.jpg "ELISA: AHR Antibody (3B12) [H00000196-M02] - Detection limit for recombinant GST tagged AHR is approximately 0.03ng/ml as a capture antibody.")
![PXR/NR1I2 Antibody (H4417) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "PXR/NR1I2 Antibody (H4417) [Unconjugated]")
![N/A IL-13 [Biotin]](https://images.novusbio.com/images2/DATA_IL13_DY413_ELISA_2010.jpg)
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![N/A IL-5 [HRP]](https://images.novusbio.com/images2/IL-5_M5000_ELISA_237.jpg)
![N/A IL-5 [HRP]](https://images.novusbio.com/images2/DATA_IL5_M5000_ELISA_935.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![N/A IL-10 [Biotin]](https://images.novusbio.com/images2/DATA_IL10_DY417_ELISA_2014.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")