![Immunocytochemistry/Immunofluorescence: AGTRAP Antibody [NBP1-91654] - Staining of human cell line A-431 shows positivity in vesicles.](http://images.novusbio.com/fullsize/AGTRAP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-91654-img0005.jpg "Immunocytochemistry/Immunofluorescence: AGTRAP Antibody [NBP1-91654] - Staining of human cell line A-431 shows positivity in vesicles.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YHMYRERGGELLVHTGFLGSSQDRSAYQTIDSAEAPADPFAVPEGRSQDARGY |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | AGTRAP |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Immunohistochemistry_6703.jpg)
![Western Blot ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Flow_Cytometry_20028.jpg)
![Simple Western ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Simple_Western_20109.jpg)
![Simple Western ACE-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE2_AF933_Simple_Western_18669.jpg)
![Immunohistochemistry ACE-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE-2_AF933_Immunohistochemistry_9800.jpg)
![Immunohistochemistry ACE-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE-2_AF933_Immunohistochemistry_10025.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for AGTRAP Antibody (NBP1-91654)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: AGTRAP Antibody [NBP1-91654] - Staining of human Skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/AGTRAP-Antibody-Immunohistochemistry-Paraffin-NBP1-91654-img0010.jpg "Immunohistochemistry-Paraffin: AGTRAP Antibody [NBP1-91654] - Staining of human Skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: AGTRAP Antibody [NBP1-91654] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.](http://images.novusbio.com/fullsize/AGTRAP-Antibody-Immunohistochemistry-Paraffin-NBP1-91654-img0002.jpg "Immunohistochemistry-Paraffin: AGTRAP Antibody [NBP1-91654] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.")
![Immunohistochemistry-Paraffin: AGTRAP Antibody [NBP1-91654] - Analysis in human epididymis and skeletal muscle tissues using NBP1-91654 antibody. Corresponding AGTRAP RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/AGTRAP-Antibody-Immunohistochemistry-Paraffin-NBP1-91654-img0006.jpg "Immunohistochemistry-Paraffin: AGTRAP Antibody [NBP1-91654] - Analysis in human epididymis and skeletal muscle tissues using NBP1-91654 antibody. Corresponding AGTRAP RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: AGTRAP Antibody [NBP1-91654] - Staining of human Epididymis shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/AGTRAP-Antibody-Immunohistochemistry-Paraffin-NBP1-91654-img0007.jpg "Immunohistochemistry-Paraffin: AGTRAP Antibody [NBP1-91654] - Staining of human Epididymis shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: AGTRAP Antibody [NBP1-91654] - Staining of human Kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/AGTRAP-Antibody-Immunohistochemistry-Paraffin-NBP1-91654-img0008.jpg "Immunohistochemistry-Paraffin: AGTRAP Antibody [NBP1-91654] - Staining of human Kidney shows strong cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: AGTRAP Antibody [NBP1-91654] - Staining of human Pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/AGTRAP-Antibody-Immunohistochemistry-Paraffin-NBP1-91654-img0009.jpg "Immunohistochemistry-Paraffin: AGTRAP Antibody [NBP1-91654] - Staining of human Pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: AGTRAP Antibody [NBP1-91654] - Staining of human Testis shows moderate cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/fullsize/AGTRAP-Antibody-Immunohistochemistry-Paraffin-NBP1-91654-img0011.jpg "Immunohistochemistry-Paraffin: AGTRAP Antibody [NBP1-91654] - Staining of human Testis shows moderate cytoplasmic positivity in Leydig cells.")
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/Angiogenin_DAN00_ELISA_28.jpg)
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/DATA_Angiogenin_DAN00_ELISA_571.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")