![Western Blot: ADPRHL2 Antibody [NBP1-88834] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/ADPRHL2-Antibody-Western-Blot-NBP1-88834-img0009.jpg "Western Blot: ADPRHL2 Antibody [NBP1-88834] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferous ducts.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VGSFYEAHDTVDLTSVLRHVQSLEPDPGTPGSERTEALYYTDDTAMARALVQSLLAKEAFDEVDMAHRFAQEYKKDPDRGYGAGVV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ADPRHL2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
Research Areas for ADPRHL2 Antibody (NBP1-88834)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: ADPRHL2 Antibody [NBP1-88834] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/ADPRHL2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88834-img0006.jpg "Immunocytochemistry/Immunofluorescence: ADPRHL2 Antibody [NBP1-88834] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.")
![Immunohistochemistry-Paraffin: ADPRHL2 Antibody [NBP1-88834] - Staining of human Fallopian tube shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ADPRHL2-Antibody-Immunohistochemistry-Paraffin-NBP1-88834-img0010.jpg "Immunohistochemistry-Paraffin: ADPRHL2 Antibody [NBP1-88834] - Staining of human Fallopian tube shows moderate cytoplasmic positivity in glandular cells.")
![Western Blot: ADPRHL2 Antibody [NBP1-88834] - Analysis in control (vector only transfected HEK293T lysate) and ADPRHL2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/ADPRHL2-Antibody-Western-Blot-NBP1-88834-img0007.jpg "Western Blot: ADPRHL2 Antibody [NBP1-88834] - Analysis in control (vector only transfected HEK293T lysate) and ADPRHL2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: ADPRHL2 Antibody [NBP1-88834] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine cells.](http://images.novusbio.com/fullsize/ADPRHL2-Antibody-Immunohistochemistry-Paraffin-NBP1-88834-img0002.jpg "Immunohistochemistry-Paraffin: ADPRHL2 Antibody [NBP1-88834] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine cells.")
![Immunohistochemistry-Paraffin: ADPRHL2 Antibody [NBP1-88834] - Staining of human placenta shows moderate cytoplasmic and nuclear positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/ADPRHL2-Antibody-Immunohistochemistry-Paraffin-NBP1-88834-img0008.jpg "Immunohistochemistry-Paraffin: ADPRHL2 Antibody [NBP1-88834] - Staining of human placenta shows moderate cytoplasmic and nuclear positivity in trophoblastic cells.")
![Immunohistochemistry Clusterin/APOJ Antibody [Unconjugated]](https://images.novusbio.com/images2/Clusterin_AF2747_Immunohistochemistry_9945.jpg)
![Immunohistochemistry Clusterin/APOJ Antibody [Unconjugated]](https://images.novusbio.com/images2/Clusterin_AF2747_Immunohistochemistry_9946.jpg)
![Western Blot Clusterin/APOJ Antibody [Unconjugated]](https://images.novusbio.com/images/af2747_mouse-clusterin-affinity-purified-polyclonal-ab-4120241240247.jpg)
![Immunohistochemistry LDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/LDL_R_AF2255_Immunohistochemistry_7149.jpg)
![Western Blot LDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/LDLR_AF2255_Western_Blot_23731.jpg)
![Western Blot LDLR Antibody [Unconjugated]](https://images.novusbio.com/images/af2255_mouse-ldl-r-affinity-purified-polyclonal-ab-4120241049445.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")