ADAM28 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ELPGVKKYEVVYPIRLHPLHKREAKEPEQQEQFETELKYKMTINGKIAVLYLKKNKNLLAPGYTETYYNSTGKEITTSPQIMDDCYY |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ADAM28 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for ADAM28 Antibody
Background
The ADAM28 gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IP, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IHC, IP, KO, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ELISA
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ICC, IHC, IP, ICFlow, WB
Species: Hu
Applications: ICC, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Publications for ADAM28 Antibody (NBP2-55995) (0)
There are no publications for ADAM28 Antibody (NBP2-55995).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ADAM28 Antibody (NBP2-55995) (0)
There are no reviews for ADAM28 Antibody (NBP2-55995).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ADAM28 Antibody (NBP2-55995) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ADAM28 Products
Research Areas for ADAM28 Antibody (NBP2-55995)
Find related products by research area.
|
Blogs on ADAM28