![Western Blot: actin-related protein 2/3 complex subunit 1B Antibody [NBP1-90114] - Analysis in human cell lines SK-MEL-30 and HEK293 using anti-ARPC1B antibody. Corresponding ARPC1B RNA-seq data are presented for the same cell lines. Loading control: anti-HDAC1.](http://images.novusbio.com/fullsize/actin-related-protein-2-3-complex-subunit-1B-Antibody-Western-Blot-NBP1-90114-img0011.jpg "Western Blot: actin-related protein 2/3 complex subunit 1B Antibody [NBP1-90114] - Analysis in human cell lines SK-MEL-30 and HEK293 using anti-ARPC1B antibody. Corresponding ARPC1B RNA-seq data are presented for the same cell lines. Loading control: anti-HDAC1.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TVCLADADKKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ARPC1B |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, WB reactivity reported in (PMID: 26655834). |
||
| Theoretical MW | 41 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: actin-related protein 2/3 complex subunit 1B Antibody [NBP1-90114] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.](http://images.novusbio.com/fullsize/actin-related-protein-2-3-complex-subunit-1B-Antibody-Immunohistochemistry-Paraffin-NBP1-90114-img0016.jpg "Immunohistochemistry-Paraffin: actin-related protein 2/3 complex subunit 1B Antibody [NBP1-90114] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.")
![Western Blot: actin-related protein 2/3 complex subunit 1B Antibody [NBP1-90114] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/actin-related-protein-2-3-complex-subunit-1B-Antibody-Western-Blot-NBP1-90114-img0006.jpg "Western Blot: actin-related protein 2/3 complex subunit 1B Antibody [NBP1-90114] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: actin-related protein 2/3 complex subunit 1B Antibody [NBP1-90114] - Analysis in human lymph node and skeletal muscle tissues. Corresponding ARPC1B RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/actin-related-protein-2-3-complex-subunit-1B-Antibody-Immunohistochemistry-Paraffin-NBP1-90114-img0012.jpg "Immunohistochemistry-Paraffin: actin-related protein 2/3 complex subunit 1B Antibody [NBP1-90114] - Analysis in human lymph node and skeletal muscle tissues. Corresponding ARPC1B RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: actin-related protein 2/3 complex subunit 1B Antibody [NBP1-90114] - Staining of human lung shows weak cytoplasmic positivity in macrophages.](http://images.novusbio.com/fullsize/actin-related-protein-2-3-complex-subunit-1B-Antibody-Immunohistochemistry-Paraffin-NBP1-90114-img0013.jpg "Immunohistochemistry-Paraffin: actin-related protein 2/3 complex subunit 1B Antibody [NBP1-90114] - Staining of human lung shows weak cytoplasmic positivity in macrophages.")
![Immunohistochemistry-Paraffin: actin-related protein 2/3 complex subunit 1B Antibody [NBP1-90114] - Staining of human small intestine shows moderate cytoplasmic positivity in lymphoid cells.](http://images.novusbio.com/fullsize/actin-related-protein-2-3-complex-subunit-1B-Antibody-Immunohistochemistry-Paraffin-NBP1-90114-img0014.jpg "Immunohistochemistry-Paraffin: actin-related protein 2/3 complex subunit 1B Antibody [NBP1-90114] - Staining of human small intestine shows moderate cytoplasmic positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: actin-related protein 2/3 complex subunit 1B Antibody [NBP1-90114] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/actin-related-protein-2-3-complex-subunit-1B-Antibody-Immunohistochemistry-Paraffin-NBP1-90114-img0015.jpg "Immunohistochemistry-Paraffin: actin-related protein 2/3 complex subunit 1B Antibody [NBP1-90114] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Western Blot Angiopoietin-like Protein 2/ANGPTL2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Angiopoietinlike_Protein_2_AF1444_Western_Blot_19840.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Western_Blot_10216.jpg)
![Immunocytochemistry RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Immunocytochemistry_10464.jpg)
![Simple Western RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Simple_Western_16629.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")