![Western Blot: ACAA1 Antibody [NBP1-86128] - Analysis using Anti-ACAA1 antibody NBP1-86128 (A) shows similar pattern to independent antibody NBP1-85786 (B).](http://images.novusbio.com/fullsize/ACAA1-Antibody-Western-Blot-NBP1-86128-img0008.jpg "Western Blot: ACAA1 Antibody [NBP1-86128] - Analysis using Anti-ACAA1 antibody NBP1-86128 (A) shows similar pattern to independent antibody NBP1-85786 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVA |
| Marker | Peroxisome Marker |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ACAA1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry Prohibitin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prohibitin_AF3470_Immunocytochemistry__Immunofluorescence_20123.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for ACAA1 Antibody (NBP1-86128)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ACAA1 |
![Immunocytochemistry/Immunofluorescence: ACAA1 Antibody [NBP1-86128] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.](http://images.novusbio.com/fullsize/ACAA1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86128-img0006.jpg "Immunocytochemistry/Immunofluorescence: ACAA1 Antibody [NBP1-86128] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.")
![Immunohistochemistry-Paraffin: ACAA1 Antibody [NBP1-86128] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/ACAA1-Antibody-Immunohistochemistry-Paraffin-NBP1-86128-img0011.jpg "Immunohistochemistry-Paraffin: ACAA1 Antibody [NBP1-86128] - Staining of human cerebral cortex.")
![Western Blot: ACAA1 Antibody [NBP1-86128] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla).](http://images.novusbio.com/fullsize/ACAA1-Antibody-Western-Blot-NBP1-86128-img0003.jpg "Western Blot: ACAA1 Antibody [NBP1-86128] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla).")
![Western Blot: ACAA1 Antibody [NBP1-86128] - Staining of human cerebral cortex, colon, kidney and liver using Anti-ACAA1 antibody NBP1-86128 (A) shows similar protein distribution across tissues to independent antibody NBP1-85786 (B).](http://images.novusbio.com/fullsize/ACAA1-Antibody-Western-Blot-NBP1-86128-img0007.jpg "Western Blot: ACAA1 Antibody [NBP1-86128] - Staining of human cerebral cortex, colon, kidney and liver using Anti-ACAA1 antibody NBP1-86128 (A) shows similar protein distribution across tissues to independent antibody NBP1-85786 (B).")
![Immunohistochemistry-Paraffin: ACAA1 Antibody [NBP1-86128] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/ACAA1-Antibody-Immunohistochemistry-Paraffin-NBP1-86128-img0001.jpg "Immunohistochemistry-Paraffin: ACAA1 Antibody [NBP1-86128] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: ACAA1 Antibody [NBP1-86128] - Staining of human liver.](http://images.novusbio.com/fullsize/ACAA1-Antibody-Immunohistochemistry-Paraffin-NBP1-86128-img0009.jpg "Immunohistochemistry-Paraffin: ACAA1 Antibody [NBP1-86128] - Staining of human liver.")
![Immunohistochemistry-Paraffin: ACAA1 Antibody [NBP1-86128] - Staining of human colon.](http://images.novusbio.com/fullsize/ACAA1-Antibody-Immunohistochemistry-Paraffin-NBP1-86128-img0010.jpg "Immunohistochemistry-Paraffin: ACAA1 Antibody [NBP1-86128] - Staining of human colon.")
![Immunohistochemistry-Paraffin: ACAA1 Antibody [NBP1-86128] - Staining of human kidney.](http://images.novusbio.com/fullsize/ACAA1-Antibody-Immunohistochemistry-Paraffin-NBP1-86128-img0012.jpg "Immunohistochemistry-Paraffin: ACAA1 Antibody [NBP1-86128] - Staining of human kidney.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Western_Blot_10680.jpg)
![Immunohistochemistry Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Immunohistochemistry_10732.jpg)
![ELISA Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_ELISA_22233.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")