![Immunohistochemistry-Paraffin: ACAA1 Antibody [NBP1-85786] - Analysis in human liver and pancreas tissues using NBP1-85786 antibody. Corresponding ACAA1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ACAA1-Antibody-Immunohistochemistry-Paraffin-NBP1-85786-img0013.jpg "Immunohistochemistry-Paraffin: ACAA1 Antibody [NBP1-85786] - Analysis in human liver and pancreas tissues using NBP1-85786 antibody. Corresponding ACAA1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQ |
| Marker | Peroxisome Marker |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ACAA1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | WB reported in scientific literature (PMID: 24762439). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Theoretical MW | 44 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry Prohibitin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prohibitin_AF3470_Immunocytochemistry__Immunofluorescence_20123.jpg)
| Publication using NBP1-85786 | Applications | Species |
|---|---|---|
| da Silva TF, Eira J, Lopes AT et al. Peripheral nervous system plasmalogens regulate Schwann cell differentiation and myelination. J Clin Invest 2014-06-01 [PMID: 24762439] (WB, Mouse) | WB | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for ACAA1 Antibody (NBP1-85786)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: ACAA1 Antibody [NBP1-85786] - Analysis using Anti-ACAA1 antibody NBP1-85786 (A) shows similar pattern to independent antibody NBP1-86128 (B).](http://images.novusbio.com/fullsize/ACAA1-Antibody-Western-Blot-NBP1-85786-img0011.jpg "Western Blot: ACAA1 Antibody [NBP1-85786] - Analysis using Anti-ACAA1 antibody NBP1-85786 (A) shows similar pattern to independent antibody NBP1-86128 (B).")
![Immunocytochemistry/Immunofluorescence: ACAA1 Antibody [NBP1-85786] - Staining of human cell line U-251MG shows positivity in vesicles. Antibody staining shown in green.](http://images.novusbio.com/fullsize/ACAA1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85786-img0003.jpg "Immunocytochemistry/Immunofluorescence: ACAA1 Antibody [NBP1-85786] - Staining of human cell line U-251MG shows positivity in vesicles. Antibody staining shown in green.")
![Immunohistochemistry-Paraffin: ACAA1 Antibody [NBP1-85786] - Staining of human pancreas shows very weak cytoplasmic positivity in a subset of exocrine glandular cells.](http://images.novusbio.com/fullsize/ACAA1-Antibody-Immunohistochemistry-Paraffin-NBP1-85786-img0017.jpg "Immunohistochemistry-Paraffin: ACAA1 Antibody [NBP1-85786] - Staining of human pancreas shows very weak cytoplasmic positivity in a subset of exocrine glandular cells.")
![Western Blot: ACAA1 Antibody [NBP1-85786] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/ACAA1-Antibody-Western-Blot-NBP1-85786-img0004.jpg "Western Blot: ACAA1 Antibody [NBP1-85786] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Immunohistochemistry-Paraffin: ACAA1 Antibody [NBP1-85786] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/ACAA1-Antibody-Immunohistochemistry-Paraffin-NBP1-85786-img0014.jpg "Immunohistochemistry-Paraffin: ACAA1 Antibody [NBP1-85786] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: ACAA1 Antibody [NBP1-85786] - Staining of human kidney shows strong granular cytoplasmic psotivity in cells in proximal tubules.](http://images.novusbio.com/fullsize/ACAA1-Antibody-Immunohistochemistry-Paraffin-NBP1-85786-img0015.jpg "Immunohistochemistry-Paraffin: ACAA1 Antibody [NBP1-85786] - Staining of human kidney shows strong granular cytoplasmic psotivity in cells in proximal tubules.")
![Immunohistochemistry-Paraffin: ACAA1 Antibody [NBP1-85786] - Staining of human ceerebral cortex shows moderate granular cytoplasmic positivity in neuronal cells.](http://images.novusbio.com/fullsize/ACAA1-Antibody-Immunohistochemistry-Paraffin-NBP1-85786-img0016.jpg "Immunohistochemistry-Paraffin: ACAA1 Antibody [NBP1-85786] - Staining of human ceerebral cortex shows moderate granular cytoplasmic positivity in neuronal cells.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Western_Blot_10680.jpg)
![Immunohistochemistry Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Immunohistochemistry_10732.jpg)
![ELISA Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_ELISA_22233.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")