![Western Blot: ABCF2 Antibody (1D11) [H00010061-M01] - ABCF2 monoclonal antibody (M01), clone 1D11 Analysis of ABCF2 expression in Hela.](http://images.novusbio.com/fullsize/ABCF2-Antibody-1D11-Western-Blot-H00010061-M01-img0012.jpg "Western Blot: ABCF2 Antibody (1D11) [H00010061-M01] - ABCF2 monoclonal antibody (M01), clone 1D11 Analysis of ABCF2 expression in Hela.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, IHC, IP, KD |
| Clone | 1D11 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | ABCF2 (AAH01661, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNS |
| Specificity | ABCF2 - ATP-binding cassette, sub-family F (GCN20), member 2 |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ABCF2 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for RNAi validation, immunohistochemistry (paraffin) and ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ABCF2 Antibody (H00010061-M01)Find related products by research area.
|
|
Cancer studies with ABCF2 ATP-binding cassette superfamily F2 (ABCF2) is a member of the ATP-binding cassette (ABC) transporter superfamily, and more specifically, a member of the GCN20 subfamily. Most members of this family are membrane proteins that transport various substra... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: ABCF2 Antibody (1D11) [H00010061-M01] - Analysis of monoclonal antibody to ABCF2 on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/ABCF2-Antibody-1D11-Immunohistochemistry-Paraffin-H00010061-M01-img0008.jpg "Immunohistochemistry-Paraffin: ABCF2 Antibody (1D11) [H00010061-M01] - Analysis of monoclonal antibody to ABCF2 on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml.")
![Western Blot: ABCF2 Antibody (1D11) [H00010061-M01] - Analysis of ABCF2 over-expressed 293 cell line, cotransfected with ABCF2 Validated Chimera RNAi ( Cat # H00010061-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ABCF2 monoclonal antibody (M01), clone 1D11 (Cat # H00010061-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.](http://images.novusbio.com/fullsize/ABCF2-Antibody-1D11-Western-Blot-H00010061-M01-img0010.jpg "Western Blot: ABCF2 Antibody (1D11) [H00010061-M01] - Analysis of ABCF2 over-expressed 293 cell line, cotransfected with ABCF2 Validated Chimera RNAi ( Cat # H00010061-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ABCF2 monoclonal antibody (M01), clone 1D11 (Cat # H00010061-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.")
![Western Blot: ABCF2 Antibody (1D11) [H00010061-M01] - Analysis of ABCF2 expression in transfected 293T cell line by ABCF2 monoclonal antibody (M01), clone 1D11.Lane 1: ABCF2 transfected lysate(68.53 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/ABCF2-Antibody-1D11-Western-Blot-H00010061-M01-img0013.jpg "Western Blot: ABCF2 Antibody (1D11) [H00010061-M01] - Analysis of ABCF2 expression in transfected 293T cell line by ABCF2 monoclonal antibody (M01), clone 1D11.Lane 1: ABCF2 transfected lysate(68.53 KDa).Lane 2: Non-transfected lysate.")
![Immunoprecipitation: ABCF2 Antibody (1D11) [H00010061-M01] - Analysis of ABCF2 transfected lysate using anti-ABCF2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ABCF2 monoclonal antibody.](http://images.novusbio.com/fullsize/ABCF2-Antibody-1D11-Immunoprecipitation-H00010061-M01-img0009.jpg "Immunoprecipitation: ABCF2 Antibody (1D11) [H00010061-M01] - Analysis of ABCF2 transfected lysate using anti-ABCF2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ABCF2 monoclonal antibody.")
![Sandwich ELISA: ABCF2 Antibody (1D11) [H00010061-M01] - Detection limit for recombinant GST tagged ABCF2 is approximately 0.3ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/ABCF2-Antibody-1D11-Sandwich-ELISA-H00010061-M01-img0011.jpg "Sandwich ELISA: ABCF2 Antibody (1D11) [H00010061-M01] - Detection limit for recombinant GST tagged ABCF2 is approximately 0.3ng/ml as a capture antibody.")
![Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunocytochemistry__Immunofluorescence_20674.jpg)
![Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunohistochemistry_20779.jpg)
![Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Western_Blot_5715.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
![Flow Cytometry Claudin-4 Antibody (382321) [Unconjugated]](https://images.novusbio.com/images2/Claudin4_MAB4219_Flow_Cytometry_21352.jpg)
